KEGG   Paenibacillus mucilaginosus 3016: PM3016_1867Help
Entry
PM3016_1867       CDS       T01757                                 

Definition
(GenBank) HxlR family transcriptional regulator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR DUF4423 HTH_27 Replic_Relax PadR HTH_20 MarR
Motif
Other DBs
NCBI-ProteinID: AFC28773
UniProt: H6NJ11
Position
complement(2102772..2103137)
Genome map
AA seq 121 aa AA seqDB search
MTLHERETASPKVASNYIPKSPENVECSIEKALDVIGGKWSFLVIRELFCGKKRFGELQR
SIQSVSPKSLTDTLRHLEEYGVLERTAYPTVPVTVEYSLTPKGEDLHQMIKEMKLWAAKW
C
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacatgagagagaaacggcttcccccaaggtagccagcaattacataccgaag
agccctgagaacgtggaatgctcgattgaaaaagccctggacgtcatcggaggcaagtgg
tccttcctggtgatccgtgaattattctgcggcaaaaagcggttcggcgagctccagcgc
agcatccaatccgtgtcccccaagtccctgacggacacgctgcgccacctcgaggaatac
ggcgtactggagaggaccgcctacccgaccgtcccggtgaccgtcgagtattcgctgacc
ccgaagggcgaggacctgcaccagatgatcaaagaaatgaagctgtgggccgccaagtgg
tgctga

DBGET integrated database retrieval system