KEGG   Paenibacillus mucilaginosus 3016: PM3016_1877Help
Entry
PM3016_1877       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 ATG22 LacY_symp BT1
Motif
Other DBs
NCBI-ProteinID: AFC28783
UniProt: H6NJ21
Position
complement(2110621..2111856)
Genome map
AA seq 411 aa AA seqDB search
MPGWKTNLTVLWFGQFLVMAGMTMIVPFLPLYLQELGVTEPHALATWSGIIFAGNFVTSF
VFQPLWGGLADRYGRKVMLLRSGFGMAVVMTLMGFATGPWHLLLLRLVNGTISGFIPAGV
ALMSATAPRERMGFAMGTLQSGAVAGSILGPLFGGLLAEWIGYRYIFYITGGLLFLASML
AALLVKETFDSKAAAQKPKQSMSAAFKQLRGIPQLPSLYAVTFLIQFSLLSVLPLLPLFV
QKLHGTGEMLAFYAGMVGSITGFSNMIASPLLGRLSDRIGPERILAICLIGAAIASVPQA
LVQNVWQLFAARFFLGIFLGGLLPTVNSLIRKYTPGGMESRSYSFNSSALSLGNMLGPVV
GGFVSGYVTIQQLFLISAVLLFVNAVWVYKSLLSRLPRKGSSGSGEAPASP
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggatggaaaacgaatctcaccgtactatggttcggacagttcttggttatggcg
ggcatgaccatgattgttccttttctccctttatatcttcaagagctcggtgttacggag
ccgcatgccctcgccacctggtcggggattatttttgcggggaacttcgtgacctcgttc
gtctttcagcccctctggggcggcctggcggaccgctacggccgcaaggtgatgctgctc
cgctcaggcttcggcatggcggtcgtcatgacgctgatgggctttgccacaggtccctgg
cacctgctgctgctgcgcctggtgaacggcacgatctccggcttcattcctgccggcgtc
gccctgatgtccgccacggctccccgcgagcggatgggcttcgccatgggtacgctgcag
tccggcgcggtcgccggctcgatcctcgggccgctgttcggcggactgctcgccgagtgg
atcggctaccggtacatcttttatatcaccggggggctgctcttcctggcttcgatgctg
gcggcgctcctcgtcaaggagacgttcgacagcaaggctgcggcccaaaagccgaagcag
tccatgtcggccgccttcaagcagcttcggggcatcccacagcttccatcgctctatgcg
gtcacgttcctgatccagttctcgctcctcagcgtgctgccgctcctccctctgttcgtg
caaaagctgcatggaacgggggagatgctggcgttctatgccgggatggtcggctcgatt
accggcttctcgaacatgatcgcctcaccgctgctcggccggttatccgaccggatcggg
cccgagcggatcctcgccatctgtctcatcggcgcggcgatagcctccgtaccgcaggcc
ctggtccagaacgtctggcagctgttcgccgcccgcttcttcctcggcatcttcctgggc
ggcctgctgccgaccgtgaacagcctcatccgcaagtatacgccgggcgggatggagagc
cgctcgtactccttcaactcgagcgccctcagcctcggcaacatgctcggaccggtcgtc
gggggcttcgtgtcggggtatgtcacgattcagcagctgtttctgatctcggccgtactc
ctgttcgtcaatgcggtgtgggtgtacaagtccctgctcagccgcctgccgcgcaaaggt
tcttccggttcaggggaggcgcccgcgtctccttaa

DBGET integrated database retrieval system