KEGG   Paenibacillus mucilaginosus 3016: PM3016_188Help
Entry
PM3016_188        CDS       T01757                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00052  Galactose metabolism
pmq00500  Starch and sucrose metabolism
pmq00520  Amino sugar and nucleotide sugar metabolism
pmq00521  Streptomycin biosynthesis
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
Module
pmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_188
   00052 Galactose metabolism
    PM3016_188
   00500 Starch and sucrose metabolism
    PM3016_188
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_188
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PM3016_188
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PM3016_188
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PM3016_188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFC27169
UniProt: H6NTM2
Position
209835..210788
Genome map
AA seq 317 aa AA seqDB search
MGDQVYVGVDLGGTAIKVGLCDEQGKLLQTYEGPTGTEHGADVVLENIAQYVRKLVAESP
YEWEQVAGVGAGIAGFMDIPEGFMKLSPNLGWRNVPVKKILEEKLGVPVKIDNDANVAAL
GEAWSGAGAGIPNVVCYTLGTGVGGGIIIHSRIYQGSNGMAGELGHMVVVPDLEAIECGC
GKKGCLETVSSGTGIIRMAKEAVARGEHTSLALVENIMAKDVFDAAKTGDETALRIINRA
ALYLGKSMAAVSVVLNPKRFIVGGGVSKAGDILFDAIRKYYQEFTQETAQEGVDIVPAVL
GNDAGVVGAAGLNLHSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggagatcaagtgtacgtaggagtcgatttgggaggaaccgcgattaaagtgggattg
tgcgacgagcagggcaagcttctgcagacgtacgaaggcccgaccggtaccgaacacggc
gcggatgtcgtgctggagaatatcgcacaatatgtgcgcaagctggtggcggaatcccct
tatgagtgggagcaggttgccggagtcggtgcggggatcgccgggtttatggatattccg
gaaggcttcatgaagctgtctcccaacctgggctggcgcaacgttccggtgaagaagatt
ctcgaggagaagctcggcgtgcctgtcaaaatcgacaacgacgccaatgtagcggcactc
ggcgaagcatggagcggagcgggtgcaggcattccgaacgtcgtctgctatacgcttgga
acaggcgttggtggaggcattatcatccacagccggatttatcagggctccaacggtatg
gcaggagagcttggtcatatggtggttgtaccggacctggaagcgatcgagtgcggatgc
ggtaagaagggctgcctcgagaccgtatcttcgggaacgggcattattcgcatggccaaa
gaagccgtggcgcgtggagagcatacttccctggccctggtggagaacatcatggcgaag
gacgtattcgatgcggcgaagaccggcgacgaaaccgcactgcggatcattaaccgggca
gcgctgtacctgggcaaatcgatggcggcggtatccgtcgtgctgaacccgaagcggttc
atcgtgggcggcggggtgtccaaagccggtgatattctgttcgatgccattcgtaagtat
taccaggaattcacacaggagactgcgcaggaaggcgtggatattgttccggccgtgctc
ggcaacgatgccggcgtagtgggcgcagcaggactgaatctgcacagcatctaa

DBGET integrated database retrieval system