KEGG   Paenibacillus mucilaginosus 3016: PM3016_1881Help
Entry
PM3016_1881       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2115624..2116451
Genome map
AA seq 275 aa AA seqDB search
MSDLLIGLLGSAGIAGAAYLKRSLSLSGFLAAVLLGTAMYSAGSAAWFGTLIAFFITSSL
LSKVKAKRKAAAEEGYAKGSRRDAGQVLANGGLGLLLCLGAALFPHPAWWAAFIGVMATV
TADTWATEVGGLSPTAPRSIVTLRPVPAGTSGGVTPLGLGASAAGGLFIGAAAWALGLLS
AEPALPAGSVASAAGLCAMGLAGGLAGSLADSWLGAVCQAMYRCSVCGRDIEKNRHCGAA
AVPVRGFSWMTNDLVNFLSSAAGGAAAWALSLVFA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctgcttatcgggctgctgggaagcgccgggattgcgggagcggcttatctc
aagcgttcgctctccctctcgggcttcctggcggccgtcctgcttggcaccgccatgtat
tccgccggcagcgcagcctggttcggcacgctgattgctttcttcatcacctcgtccctg
ctctcgaaggttaaggcgaagcgcaaggcggcggccgaggaaggctacgcgaagggcagc
cggcgcgatgcgggccaggtgctcgccaacggcggcctcggcctgctgctctgcctgggc
gcggccctcttcccgcatccggcctggtgggccgccttcatcggcgtgatggccacggtc
acggccgacacctgggccaccgaggtcggcggcctcagccccaccgcgccgcggtcgatc
gtcacgctccgccccgtgccggccggcacctccggcggcgtgacgccgcttggcctcggc
gcctccgctgccggcggcctcttcatcggcgcggccgcgtgggcgctgggcctgctgtcc
gcggagccggcgctgccggccggctcggtggcttcggctgccgggctctgcgccatgggc
ctggccggcggtctcgccggctcgctggccgactcgtggcttggcgcggtctgccaagcg
atgtaccggtgcagcgtctgcggccgggacatcgaaaaaaaccgccactgcggggcagcg
gcggttccggttcggggcttctcctggatgacgaacgatctcgtcaacttcctgagctcg
gcggccggcggtgcggccgcatgggcgctgagtctggttttcgcgtaa

DBGET integrated database retrieval system