KEGG   Paenibacillus mucilaginosus 3016: PM3016_1902Help
Entry
PM3016_1902       CDS       T01757                                 

Definition
protein PfkA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:pmq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmq00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pmq00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmq00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmq00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2136320..2137285
Genome map
AA seq 321 aa AA seqDB search
MSVKKIAVLTSGGDSQGMNAAVRAVVRSGLFHGLEVFAVQRGYAGLINDDIRPMDLRSVG
DIIQRGGTVLQTARCKEFLTPEGQQLGADNLRKHGIDGLVVIGGDGSYQGANKLSKLGIK
TMGLPGTIDNDIPFTDFTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIAL
YAGLASGAETIIVPEVGYDMDEISNRMAENFAQGKRHSIIIVAEGVCGGDEIAAEITKRN
GIEPRVTVLGHIQRGGAPTHNDRILASSLGDFAVRKLIEGDSGKACGIIKGELTVTDIDK
VVNTKKPFNMELYELAKRLSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaagattgcagtactcaccagcggcggcgattcccaggggatgaacgca
gccgtccgcgccgttgtgcgcagcggcctgttccacggcctcgaagtgttcgccgtccag
cgcggttacgcgggcctgatcaacgatgacatccgtccgatggacctgcgcagcgtcggc
gatattatccagcgcggcggcacggtgctccagacggctcgctgtaaggagttcctgacg
ccggaaggacagcagctcggcgcggacaacctgcgcaagcacggcatcgacggactcgtc
gtgatcggcggggacggctcgtaccagggcgcgaacaagctcagcaagctcggcatcaag
acgatgggcctgccgggcaccatcgacaacgacatcccgttcacggacttcacgatcggc
ttcgatacggcggtctccatcgtggtcgatgcgatcaacaagctgcgtgatacgatgagc
tcgcatgagcgttcgtccatcgtggaagtcatgggccgccactgcggcgacatcgccctg
tatgcgggccttgcgagcggtgcggagacgatcatcgtgccggaagtcggctacgatatg
gacgagatctcgaaccggatggcagagaacttcgcccagggcaagcgccacagtatcatc
atcgtggcggaaggggtctgcggcggcgacgagatcgcggcggagatcaccaagcgcaac
ggcatcgagccgcgcgtaaccgtgctcggccatattcagcgcggcggtgcgccgacgcat
aatgaccggatcctcgcgagcagcctcggcgacttcgccgtgcgcaagctgatcgagggc
gactcgggcaaggcctgcggcatcatcaagggcgagctgaccgtgaccgacatcgacaag
gtcgtcaacacgaagaagccgttcaacatggagctgtacgagctcgcgaagcgtctgtcc
caataa

DBGET integrated database retrieval system