KEGG   Paenibacillus mucilaginosus 3016: PM3016_199Help
Entry
PM3016_199        CDS       T01757                                 

Definition
(RefSeq) TpiA protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PM3016_199
   01230 Biosynthesis of amino acids
    PM3016_199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_199
   00051 Fructose and mannose metabolism
    PM3016_199
   00562 Inositol phosphate metabolism
    PM3016_199
Enzymes [BR:pmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PM3016_199
Exosome [BR:pmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PM3016_199
  Exosomal proteins of bladder cancer cells
   PM3016_199
  Exosomal proteins of melanoma cells
   PM3016_199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222331..223083
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFTNLPALVEAVKGTTLKV
GAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFGETDEIVNKKVQAAFKHGL
TPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQVVIAYEPIWAIGTGKSSTAA
DAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNIAEYMQQPDIDGALVGGASLEPA
SYIALIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggcaactggaaaatgtttaaaaccgtacaggaagccgtt
tctttcgtgaacgaagtaaaaggcaaagcggaagtggaaggcgtggagagcgtcatctgc
tccccgttcacgaatcttcctgccctggtggaagcggtgaaaggcacgacgctcaaagtc
ggcgcccagaacctccacttcgaagacaacggtgcttacacgggtgagatcagcggcgtt
atgctgaaggatctcggcgtagagtacgtcatcatcggtcactccgagcgccgggcttac
tttggcgagacggacgagatcgtgaacaagaaggtccaagcggcattcaaacacggtctg
actccgatcgtctgcgtaggcgagaagctcgaagagcgcgaagcgaaccagaccaaggac
gtatgcaaagtgcagaccgaaggcgcatttgcaggcctgagcgcagaacaggcggcacag
gtggtcatcgcctatgagccgatctgggctatcggaacaggcaaatcttctacagctgca
gacgctcaagacgtgatcggctacatccgtgaagtcgtgagcggcctgtatggcgccgag
acggctgcagcggtacgcatccagtacggcggcagcgtgaagccgaacaatattgcggaa
tacatgcagcagccggatatcgacggcgcgcttgtaggcggagcttccctggagccggcg
tcctacatcgccctgatcgagggggccaagtaa

DBGET integrated database retrieval system