KEGG   Paenibacillus mucilaginosus 3016: PM3016_204Help
Entry
PM3016_204        CDS       T01757                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     PM3016_204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
227503..228306
Genome map
AA seq 267 aa AA seqDB search
MTRQYRTTEPFHLKGTGERASTELLLIHGFTGSPSEFRRLGYYLNDLGYTVRGILLPGHG
TTPEDMIRTGLNDWSRHVTESFDTIRAQGGPDRRIVAVGHSMGGLLALKLAMERPLAGVV
SLAAPIFLASRKTVLAVLLQYFVKYVERRPTVPPHIIEEACSYSRTPIPCVVDLRKLLKH
VKTSLNEVKAPLFIGQGGRDKLVLPRSAEYIYRHVSSAFRQMAHYPSTSHAILLDEERER
VYADIHRFLVTLEHIGTWEQTAAGYAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcggcagtatcgaacaacggagccctttcacctgaagggaacgggagagcgggca
tccacggaactcctgcttatccacgggttcaccggttcgccttcggagttccgccgcctg
ggctactacttgaacgatctgggctataccgtaagggggatcctgctgccgggccacgga
acgacgcccgaggatatgatccgtacggggctgaacgactggtccaggcatgtgacggag
agcttcgacaccatccgggcgcagggcggtccggatcggcggatcgtagccgtaggacat
tcgatgggcggtctcctggccttgaagctggcgatggagcgtccgctggccggggtcgtc
tccctcgccgcaccgatcttcctggcctcgcgcaagaccgtactggccgtgctgctgcag
tattttgtgaagtatgtggagcggcgtccgaccgtcccccctcatatcatcgaggaagcc
tgctcctacagccgtacgccgattccttgtgtcgtggatttgcgcaagctgcttaagcac
gtcaaaaccagtttaaatgaagtaaaagccccgctttttatcggacaagggggaagggac
aagcttgtgctgccgcgcagtgcggagtacatctaccgccatgtctcctcggccttccgg
cagatggcccattacccctccacctcgcatgccatcctgctggatgaggagcgggagcgg
gtatacgcggatattcaccgatttctggtgacgcttgagcatatagggacatgggaacaa
acggcggcggggtatgcgccataa

DBGET integrated database retrieval system