KEGG   Paenibacillus mucilaginosus 3016: PM3016_2827Help
Entry
PM3016_2827       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PM3016_2827
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PM3016_2827
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PM3016_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3283667..3284452
Genome map
AA seq 261 aa AA seqDB search
MSQLLRDRTALITGAASGIGLEIARTFAKEGARVVVTDIRTEGALQAASLLQEEGFEALG
LRCDVTQEGEYAAALQAADETYGSLDILVNNAGLQHVAPLEDFPVDKFEFMIKVMLTGAF
IGIKHAFPLMKRGGYGRVINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEGASHGIT
VNALCPGYVDTPLVRGQLEDLARTRGVPLESVLEEVIYPLVPQRRLLTVEEIADYAVLIA
SDKLRGVTGASLLIDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagctgcttagagaccgcaccgccctcatcacgggggcggccagcggcatcgga
ttggagatcgcaaggacattcgcaaaggaaggggcccgggtggtcgtcactgacatccgg
accgagggggcgctgcaggcggcttccctgctgcaggaggaaggcttcgaagcgctcggc
ctgcggtgcgacgtgacgcaggaaggggagtatgcggcggcgcttcaggcagcggacgag
acgtacggctcgctcgatattctcgtcaataatgcgggactgcagcatgtggcgccgctt
gaggactttcctgtggacaaattcgagttcatgatcaaggtgatgcttacgggagctttt
atcggaatcaagcatgcgtttccgctgatgaagcggggcgggtacgggcgcgtcatcaac
atggcgtcgatcaacggggtaatcgggttcgccggcaaggcggcttacaacagtgcgaag
cacggattgatcggcctgacgaaggtggcggcgctcgaaggggcgtcccacgggatcacc
gtgaatgcgctctgtccgggctacgtcgatacgccgctggtccgcgggcagctcgaggat
ctggcgcgtacgcggggcgtaccgctcgagagcgtgctcgaggaagtgatctatccgctc
gtgccgcagcgcaggctgctgacggtggaggagattgcggactacgccgtgctgatcgcc
agcgacaagctgcggggcgtaacgggggcgtcgctgctgatcgatggaggctatactgca
cagtag

DBGET integrated database retrieval system