KEGG   Paenibacillus mucilaginosus 3016: PM3016_3039Help
Entry
PM3016_3039       CDS       T01757                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM3016_3039
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM3016_3039
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PM3016_3039
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PM3016_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3472668..3473501
Genome map
AA seq 277 aa AA seqDB search
MNRIDAKFAALKEQELTAFIPFLTIGDPDVRTSIDIIHELEKAGASMVELGVPYSDPLAD
GPVIQRSSMRALKANRITILDVIGAAKTAREEGSELPFILFTYYNPVLQTGLDRIFPLLV
ESSISGLIIPDLPMEEDEEVRRLAEQHGIHLIPLVAPTSRERVERIASRASGFVYCVSSL
GVTGTRTEFHTGIDEFLSTVKGATSLPIAIGFGISTPEQVARFSGVCDGIVVGSALVRTV
EEALPLLSEPASRREGLLQIHDFVRTLVGNGSGIVRT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgacgccaaattcgctgctctgaaggagcaggagcttaccgcattcatt
ccgttcctcaccattggtgacccggatgtccgcacctcgatcgacatcattcacgagctg
gagaaggccggcgcttccatggtggagctcggcgtgccttattccgatccgctggccgac
gggccggtcatccagcgttcctccatgcgggcgctcaaggcgaaccggatcacgattctc
gatgtgatcggggccgccaagacggcgagggaggaaggcagcgagctgccgttcattttg
tttacctattataatccggtgctgcaaaccggccttgaccggatcttcccgcttctggtg
gagagcagcatcagcggcctcattatccctgatctgccgatggaagaggatgaggaagtg
cgccggctggcggagcagcacggcatccacctgattccgctggtggcgccgacctcccgg
gagcgcgtggaacggatcgcttccagagcgagcgggttcgtttactgcgtgtcctcgctt
ggcgtgaccggcacccggaccgagttccatacgggcatcgacgagttcctgagcaccgtc
aagggagcgacttcgctgccgatcgccatcggcttcggcatctcgacgccggagcaggtg
gcccgcttctcgggggtctgcgacggcattgtcgtcggcagcgcccttgtgcggacggtc
gaagaggcgctgcctctgctgtccgagccggcctcccgcagagaaggactcttgcaaatt
catgattttgtgcgtacattagtgggaaacggttccggcatcgtgcggacctga

DBGET integrated database retrieval system