KEGG   Paenibacillus mucilaginosus 3016: PM3016_3039Help
Entry
PM3016_3039       CDS       T01757                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM3016_3039
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PM3016_3039
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PM3016_3039
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PM3016_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3472668..3473501
Genome map
AA seq 277 aa AA seqDB search
MNRIDAKFAALKEQELTAFIPFLTIGDPDVRTSIDIIHELEKAGASMVELGVPYSDPLAD
GPVIQRSSMRALKANRITILDVIGAAKTAREEGSELPFILFTYYNPVLQTGLDRIFPLLV
ESSISGLIIPDLPMEEDEEVRRLAEQHGIHLIPLVAPTSRERVERIASRASGFVYCVSSL
GVTGTRTEFHTGIDEFLSTVKGATSLPIAIGFGISTPEQVARFSGVCDGIVVGSALVRTV
EEALPLLSEPASRREGLLQIHDFVRTLVGNGSGIVRT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggatcgacgccaaattcgctgctctgaaggagcaggagcttaccgcattcatt
ccgttcctcaccattggtgacccggatgtccgcacctcgatcgacatcattcacgagctg
gagaaggccggcgcttccatggtggagctcggcgtgccttattccgatccgctggccgac
gggccggtcatccagcgttcctccatgcgggcgctcaaggcgaaccggatcacgattctc
gatgtgatcggggccgccaagacggcgagggaggaaggcagcgagctgccgttcattttg
tttacctattataatccggtgctgcaaaccggccttgaccggatcttcccgcttctggtg
gagagcagcatcagcggcctcattatccctgatctgccgatggaagaggatgaggaagtg
cgccggctggcggagcagcacggcatccacctgattccgctggtggcgccgacctcccgg
gagcgcgtggaacggatcgcttccagagcgagcgggttcgtttactgcgtgtcctcgctt
ggcgtgaccggcacccggaccgagttccatacgggcatcgacgagttcctgagcaccgtc
aagggagcgacttcgctgccgatcgccatcggcttcggcatctcgacgccggagcaggtg
gcccgcttctcgggggtctgcgacggcattgtcgtcggcagcgcccttgtgcggacggtc
gaagaggcgctgcctctgctgtccgagccggcctcccgcagagaaggactcttgcaaatt
catgattttgtgcgtacattagtgggaaacggttccggcatcgtgcggacctga

DBGET integrated database retrieval system