KEGG   Paenibacillus mucilaginosus 3016: PM3016_309Help
Entry
PM3016_309        CDS       T01757                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_309
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PM3016_309
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PM3016_309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352204..353508
Genome map
AA seq 434 aa AA seqDB search
MKKAARWLCLLLGLAAAAGIEGCGSQSPVPPAGQQPPQSLQPERSGNEAAQEPVEPAMKP
RDDIRDRVEAMSLDEKVGQLLLVGLEGTEVDGRAREWIHTYHAGGFILFRDNIQNTAQLA
KLVGDLKEANRSSGGVPLWLSLDEEGGRVSRMPAELTKPPSAAAVGRADKPAASLAVGRA
VGRELAAFGMNMNFAPVLDVFSNPANTVIGDRAYGRDPAQVSRIGIQTMKGLQSQQVAAV
VKHFPGHGDTVEDSHYGLPVVAHDLERLRKLELKPFAEAITSGADAVMVAHILLPKLDAE
APASLSRRIVTGLLREEMGFGGVVVTDDLVMGAITKRYDLGQAGVQAVAAGVDVLLVGHG
HEAGTAVFSAVKRAVQEGVITEARLKESVTRILRLKAKYRLTDERPGAVDTAALNAGLKN
AMKELEVTAPAGGK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagcgagatggctgtgcctgctgctgggtctggcggccgctgcagggata
gaggggtgcggttcccaatcaccggtgcctccggccgggcagcagcccccccagtccctg
cagccggagcggtccggtaatgaggctgcacaggagcccgttgaaccggcgatgaagccg
cgtgatgacatccgggaccgggtggaggccatgtccctggatgagaaagtaggccagctg
ctgctggtcgggttggaaggcaccgaagtggacgggcgtgcgcgggagtggatacatacg
tatcatgcaggaggcttcatcctgttccgggataacattcagaatacggcccagctggcg
aagctggtcggagatctgaaggaagcgaaccgcagctccgggggcgtgccgctgtggctg
agcctggatgaggagggcggccgggtcagccggatgccggcggagctcaccaagccgcct
tccgccgcggcggtcggccgggcggacaagcctgccgcctcgctggcggtcggccgcgcc
gtcggccgggagcttgccgccttcgggatgaacatgaattttgccccggtgctggatgtg
ttcagcaatccggccaatacggtgatcggggaccgggcctacggccgcgacccggcacag
gtcagccgcataggcatccagacgatgaaggggctgcagtcccagcaggtggcggcggtg
gtgaagcacttcccgggccatggagatacggtggaggattcgcactacgggctgcccgtg
gtcgcgcatgatctggagcggctgcggaagctggagctgaagccgttcgccgaagcgata
acaagcggggccgatgccgtcatggtcgctcatattctcctgccgaagctggatgcggaa
gcgccggcctcgctctcccgccggatcgtgacgggccttctcagggaggagatgggcttc
ggcggcgtcgtggtaaccgacgacctcgtgatgggcgccattaccaagcgctacgatctc
gggcaggcgggtgtgcaggcggtggcggcaggtgtagatgtgctgctcgtcgggcatgga
cacgaggccggcacggccgtgttctccgccgtgaagcgcgccgtgcaggagggggtcatt
acggaagcaaggctgaaggagagcgtcacccggatcctgcggctgaaggcgaagtaccgg
ctcaccgacgaacgtccgggggctgtggacaccgccgccctgaacgccgggctgaagaac
gcgatgaaagagctggaagtaacggccccggccggagggaagtag

DBGET integrated database retrieval system