KEGG   Paenibacillus mucilaginosus 3016: PM3016_3096Help
Entry
PM3016_3096       CDS       T01757                                 

Definition
protein GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3536588..3538540
Genome map
AA seq 650 aa AA seqDB search
MSSLIPEPEDLYLFHEGNLFRSYRMLGAHTGTWNGADGVRFTVWAPHAREVRVVGDFNNW
DGSAHAMHRISTWGVWTLFIPEVSEGEYYKYEILTSQGTLIYKADPYGFWAELKPGTASR
IYNLDGFEWSDGAWQEKKRTTPVYNAPMNIYEVHLGTWKKREDGSYYTYRELADELVSYV
AEMGYTHIELMPLAEHPYDRSWGYQATGYYSVTSRFGTPKDFMYFVDCCHAAGIGVIMDW
VPGHFVKDEHGLRQFDGEPLYEYRDEARAEKPEWGTLSFDFTKPEVVSFLISSALFWFDM
YHIDGLRVDAVASLLYLNFGKPRELWVKNEHGGDENTEAIAFLKKLNHTVFSAYPDALMM
AEDSSAWPLVTAPVHAGGLGFNYKWNMGWMNDMLKYMEMDPYFRGGNHQLLTFSFMYTHA
ENYVLPLSHDEVVHGKRSLLNKMPGDYWQKFANLRVLYGYMMSHPGKKLLFMGGEFGQFD
EWKDLEDLDWEMLGYESHNSMHRYVKDLNHLYLAEPSLWELDHSPEGFSWIDPNDQKQSV
TTFMRISKKPEDTLIIVNNFTPVYHERYRIGVPFSGEYVERFNSDAGEYGGSGKLNAGRL
KTDGISWHYQQDSLHISLPPLSTVMFKPVRIMPPPAKPAAPKRGRGKADA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtctaatccccgaaccggaagacttgtatctgttccatgaagggaacctgttc
cgcagctaccgcatgctgggagcgcacaccggaacatggaacggagcggacggcgtccgc
ttcacggtatgggccccgcacgcccgggaagtccgggtggtgggcgatttcaacaattgg
gacggctcagcccacgccatgcacaggatcagcacctggggcgtgtggacgctgttcatt
ccggaagttagtgaaggggagtattacaagtacgaaattctgacatcgcagggaacactg
atctacaaagcggatccgtacggattctgggcggagctcaagcccggtacggcatcccgg
atttacaacctggacggattcgaatggtccgacggggcctggcaggagaagaagcggacg
actccggtgtacaatgcacccatgaacatctatgaagtgcacctcggcacctggaagaag
cgggaggacggctcgtactatacataccgggaacttgcggacgagctggtctcttatgtg
gcggagatggggtacacccacatcgagctgatgccgctcgccgagcatccgtacgaccgc
tcctggggctaccaggccacgggctattattcggtgacgagccggttcggcacaccgaaa
gattttatgtattttgtggactgctgccacgcggcgggcatcggggtcatcatggactgg
gtgccgggccacttcgtcaaggacgagcacgggctgcggcagttcgacggggaacccttg
tacgagtaccgcgacgaggcccgggcggagaagccggaatggggaacgctttcttttgac
tttacgaagccggaagtcgtgtccttcctcatctccagcgccttgttctggttcgacatg
tatcacattgacggtctgcgggtcgatgccgtcgcctcgctgctctatctcaacttcggc
aagccgcgcgagctgtgggtgaagaacgagcatgggggagacgagaacaccgaagcgatc
gccttcctcaaaaaactgaatcataccgtcttcagcgcctatcccgacgcgctcatgatg
gccgaggattcctccgcctggccgctcgttacggcgccggtgcatgccggagggctcggt
ttcaactacaaatggaatatgggctggatgaatgatatgctgaaatatatggagatggat
ccctacttccggggaggcaaccaccagctcctgaccttctcgttcatgtacacccatgcc
gagaattatgtgcttccgctctcgcacgacgaggtcgtgcacggcaagcgctcgctgctg
aacaagatgccgggggattactggcagaagttcgcgaatctgcgggtgctgtacgggtac
atgatgtcccatccgggcaagaagctgctcttcatgggcggcgaattcggccagttcgat
gagtggaaggatctcgaggatctcgactgggagatgctcggctatgagagccacaactcc
atgcaccgctatgtgaaggatctgaatcacctgtacctggccgagccctccctctgggag
ctcgaccacagtcccgaaggcttctcctggatcgatccgaacgaccagaagcagagcgta
accacgttcatgcggatttcgaaaaagccggaggataccctcatcatcgtcaacaatttt
acgcctgtgtatcacgaacggtaccggatcggcgttcccttctccggggaatacgtcgaa
cgcttcaacagcgatgcgggggaatacgggggaagcggcaagctgaacgccggcaggctc
aagacggatggcatctcctggcattaccagcaggacagtctgcatatttcgctgccgccg
ctctcgaccgtaatgttcaagccggtgaggatcatgccgccgcccgccaaacccgccgca
cccaaacgaggaaggggtaaagccgatgcgtaa

DBGET integrated database retrieval system