KEGG   Paenibacillus mucilaginosus 3016: PM3016_3096Help
Entry
PM3016_3096       CDS       T01757                                 

Definition
protein GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PM3016_3096
Enzymes [BR:pmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PM3016_3096
Exosome [BR:pmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PM3016_3096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3536588..3538540
Genome map
AA seq 650 aa AA seqDB search
MSSLIPEPEDLYLFHEGNLFRSYRMLGAHTGTWNGADGVRFTVWAPHAREVRVVGDFNNW
DGSAHAMHRISTWGVWTLFIPEVSEGEYYKYEILTSQGTLIYKADPYGFWAELKPGTASR
IYNLDGFEWSDGAWQEKKRTTPVYNAPMNIYEVHLGTWKKREDGSYYTYRELADELVSYV
AEMGYTHIELMPLAEHPYDRSWGYQATGYYSVTSRFGTPKDFMYFVDCCHAAGIGVIMDW
VPGHFVKDEHGLRQFDGEPLYEYRDEARAEKPEWGTLSFDFTKPEVVSFLISSALFWFDM
YHIDGLRVDAVASLLYLNFGKPRELWVKNEHGGDENTEAIAFLKKLNHTVFSAYPDALMM
AEDSSAWPLVTAPVHAGGLGFNYKWNMGWMNDMLKYMEMDPYFRGGNHQLLTFSFMYTHA
ENYVLPLSHDEVVHGKRSLLNKMPGDYWQKFANLRVLYGYMMSHPGKKLLFMGGEFGQFD
EWKDLEDLDWEMLGYESHNSMHRYVKDLNHLYLAEPSLWELDHSPEGFSWIDPNDQKQSV
TTFMRISKKPEDTLIIVNNFTPVYHERYRIGVPFSGEYVERFNSDAGEYGGSGKLNAGRL
KTDGISWHYQQDSLHISLPPLSTVMFKPVRIMPPPAKPAAPKRGRGKADA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtctaatccccgaaccggaagacttgtatctgttccatgaagggaacctgttc
cgcagctaccgcatgctgggagcgcacaccggaacatggaacggagcggacggcgtccgc
ttcacggtatgggccccgcacgcccgggaagtccgggtggtgggcgatttcaacaattgg
gacggctcagcccacgccatgcacaggatcagcacctggggcgtgtggacgctgttcatt
ccggaagttagtgaaggggagtattacaagtacgaaattctgacatcgcagggaacactg
atctacaaagcggatccgtacggattctgggcggagctcaagcccggtacggcatcccgg
atttacaacctggacggattcgaatggtccgacggggcctggcaggagaagaagcggacg
actccggtgtacaatgcacccatgaacatctatgaagtgcacctcggcacctggaagaag
cgggaggacggctcgtactatacataccgggaacttgcggacgagctggtctcttatgtg
gcggagatggggtacacccacatcgagctgatgccgctcgccgagcatccgtacgaccgc
tcctggggctaccaggccacgggctattattcggtgacgagccggttcggcacaccgaaa
gattttatgtattttgtggactgctgccacgcggcgggcatcggggtcatcatggactgg
gtgccgggccacttcgtcaaggacgagcacgggctgcggcagttcgacggggaacccttg
tacgagtaccgcgacgaggcccgggcggagaagccggaatggggaacgctttcttttgac
tttacgaagccggaagtcgtgtccttcctcatctccagcgccttgttctggttcgacatg
tatcacattgacggtctgcgggtcgatgccgtcgcctcgctgctctatctcaacttcggc
aagccgcgcgagctgtgggtgaagaacgagcatgggggagacgagaacaccgaagcgatc
gccttcctcaaaaaactgaatcataccgtcttcagcgcctatcccgacgcgctcatgatg
gccgaggattcctccgcctggccgctcgttacggcgccggtgcatgccggagggctcggt
ttcaactacaaatggaatatgggctggatgaatgatatgctgaaatatatggagatggat
ccctacttccggggaggcaaccaccagctcctgaccttctcgttcatgtacacccatgcc
gagaattatgtgcttccgctctcgcacgacgaggtcgtgcacggcaagcgctcgctgctg
aacaagatgccgggggattactggcagaagttcgcgaatctgcgggtgctgtacgggtac
atgatgtcccatccgggcaagaagctgctcttcatgggcggcgaattcggccagttcgat
gagtggaaggatctcgaggatctcgactgggagatgctcggctatgagagccacaactcc
atgcaccgctatgtgaaggatctgaatcacctgtacctggccgagccctccctctgggag
ctcgaccacagtcccgaaggcttctcctggatcgatccgaacgaccagaagcagagcgta
accacgttcatgcggatttcgaaaaagccggaggataccctcatcatcgtcaacaatttt
acgcctgtgtatcacgaacggtaccggatcggcgttcccttctccggggaatacgtcgaa
cgcttcaacagcgatgcgggggaatacgggggaagcggcaagctgaacgccggcaggctc
aagacggatggcatctcctggcattaccagcaggacagtctgcatatttcgctgccgccg
ctctcgaccgtaatgttcaagccggtgaggatcatgccgccgcccgccaaacccgccgca
cccaaacgaggaaggggtaaagccgatgcgtaa

DBGET integrated database retrieval system