KEGG   Paenibacillus mucilaginosus 3016: PM3016_3161Help
Entry
PM3016_3161       CDS       T01757                                 

Definition
protein MtnD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pmq00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3600077..3600622)
Genome map
AA seq 181 aa AA seqDB search
MAEIRIRNTGERISGEENVRSFLDKQEVLYEHWNAAKLPAELQEKFVLSDEEKAQILSTF
DEEIRDLAGRRGYKTWDVIALSDATPNLDELLKKFESVHTHTEDEVRAITAGRGIFIIKG
TDDVGYFDVELEAGDVISVPEHKAHFFTLMENRKIVAVRLFIETEGWIAHPYDDPAFQKA
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatccgcatccgcaacacaggcgagcgcatctccggcgaagagaatgtgaga
tcgttcttagataagcaagaggttctgtatgagcactggaacgcagcgaagctgccggcc
gagctgcaggagaagttcgtgctgagcgacgaagagaaggcacagatcctctccaccttc
gacgaagagatccgtgatcttgcaggccgccgcggttacaaaacctgggatgttatcgcc
ctctccgacgctacaccgaacctggacgagctgctgaagaaattcgagtccgtccacacc
cacacggaagatgaagtgcgggccattacggcaggccggggcatcttcatcatcaaaggc
accgacgatgtcggatacttcgacgttgagctggaagccggcgacgtgatctccgtaccg
gagcacaaagcccacttcttcaccctgatggagaaccgcaagatcgttgccgtccgcctg
ttcatcgagacggaaggctggatcgctcatccttacgacgaccctgcgttccaaaaagct
caataa

DBGET integrated database retrieval system