KEGG   Paenibacillus mucilaginosus 3016: PM3016_3180Help
Entry
PM3016_3180       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pmq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3623834..3624643
Genome map
AA seq 269 aa AA seqDB search
MPELPEMENYRILLSGRITGRTITGAEIGREKSINVAPERFRMDVIGSSVRVIERRAKHL
LFHLTTGNVLVLHLMIGGILYYGRLEDQPDRTIQVRISFGDEHLFFIGLRLGYLHLHTPE
ETAELMKKLGPDPFDPELTEEAFEQRLRPRKGTLKSNLVDQSVLAGIGNCYSDEICFMAK
LLPSRRPATLSTEEYRKLHASMREVLTEATRYGGYMEMPLYPGDPLTGGFDARCRVYDAE
GKPCERCGQPIVRQEVSSKKSFCCLNCQH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttcccgaaatggagaattaccgtattctgctcagcggccgcatcacgggc
cggacgatcaccggcgccgagatcggccgggagaagtccatcaacgtggcgcccgagcgg
ttccgcatggatgtgatcggctcgtccgtccgtgtcatcgagcgccgtgcgaagcacctg
ctgtttcatctgacaacagggaacgtgctcgtgctgcacctcatgatcggcggcattcta
tattacggcaggctcgaggatcagccggaccgtacgatacaggtgcgcatctcatttggg
gatgagcatctgttttttattggactgcgcctcggctacctgcacctgcatacgccggag
gagacggccgagctgatgaagaagctcggacccgacccgttcgacccggagctgaccgag
gaagcgttcgagcagcggctgcgcccccgcaaggggacgctcaagagcaatctcgtcgac
cagagcgtgctggccggcatcggcaactgctacagcgacgagatctgcttcatggcgaag
cttctgccttccaggcgtccggccacgttatccactgaggaataccggaagctgcatgcc
tccatgcgggaggtgctgacggaagcgacccggtacggcggctatatggagatgcccttg
tacccgggcgatcccttgaccggcggattcgatgcccgctgccgtgtgtacgatgcggag
ggcaagccgtgcgagcggtgcggccagcccatcgtccggcaggaggtctcgtcgaagaag
tcgttctgctgtctgaactgccagcactga

DBGET integrated database retrieval system