KEGG   Paenibacillus mucilaginosus 3016: PM3016_3250Help
Entry
PM3016_3250       CDS       T01757                                 

Definition
protein BsaA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pmq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pmq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3693334..3693912
Genome map
AA seq 192 aa AA seqDB search
MRWVLFPEPPHDTIGSTAVSRDTAIPNQGEMNTMSVYDYAVRTIDGQEKTLAEYKGKVLL
IVNTASACGLTPHYQGLQELYEGYKDQGLVVLGFPCNQFAGQEPGTEEEIKQFCELKYNV
TFPMFSKVDVKGENAHPLFTYLVGNVPEDTRTGDIEWNFVKFLVDREGRPVKQFSARTEP
SALREDVEKLLG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgggttttatttcctgagcctcctcatgatacaataggatcaactgccgtcagt
agggatacggccattccaaaccagggagagatgaatacgatgtcggtatacgattatgcg
gtccgcacgatcgacggccaggagaagacgctggcggaatacaaaggcaaggtgctgctc
atcgtgaacacggcgagcgcctgcggcctgacgccgcactaccagggactccaggagctg
tatgaaggctacaaggaccaagggctggtcgtgctgggcttcccgtgcaaccagttcgcc
gggcaggagccgggcaccgaagaagagatcaagcagttctgcgagctgaaatacaacgta
acgttcccgatgttctccaaggtggatgtcaagggcgagaatgcgcacccgctcttcacg
tacctcgtcggcaatgtgccggaggacacgcgcacgggcgacatcgagtggaacttcgtg
aagttcctggtcgaccgcgaaggcaggccggtcaagcagttcagcgcacgtaccgagccg
tcggccctgcgggaggacgtcgagaagctgctcggatag

DBGET integrated database retrieval system