KEGG   Paenibacillus mucilaginosus 3016: PM3016_3250Help
Entry
PM3016_3250       CDS       T01757                                 

Definition
protein BsaA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PM3016_3250
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PM3016_3250
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PM3016_3250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3693334..3693912
Genome map
AA seq 192 aa AA seqDB search
MRWVLFPEPPHDTIGSTAVSRDTAIPNQGEMNTMSVYDYAVRTIDGQEKTLAEYKGKVLL
IVNTASACGLTPHYQGLQELYEGYKDQGLVVLGFPCNQFAGQEPGTEEEIKQFCELKYNV
TFPMFSKVDVKGENAHPLFTYLVGNVPEDTRTGDIEWNFVKFLVDREGRPVKQFSARTEP
SALREDVEKLLG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgggttttatttcctgagcctcctcatgatacaataggatcaactgccgtcagt
agggatacggccattccaaaccagggagagatgaatacgatgtcggtatacgattatgcg
gtccgcacgatcgacggccaggagaagacgctggcggaatacaaaggcaaggtgctgctc
atcgtgaacacggcgagcgcctgcggcctgacgccgcactaccagggactccaggagctg
tatgaaggctacaaggaccaagggctggtcgtgctgggcttcccgtgcaaccagttcgcc
gggcaggagccgggcaccgaagaagagatcaagcagttctgcgagctgaaatacaacgta
acgttcccgatgttctccaaggtggatgtcaagggcgagaatgcgcacccgctcttcacg
tacctcgtcggcaatgtgccggaggacacgcgcacgggcgacatcgagtggaacttcgtg
aagttcctggtcgaccgcgaaggcaggccggtcaagcagttcagcgcacgtaccgagccg
tcggccctgcgggaggacgtcgagaagctgctcggatag

DBGET integrated database retrieval system