KEGG   Paenibacillus mucilaginosus 3016: PM3016_3460Help
Entry
PM3016_3460       CDS       T01757                                 

Definition
hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3938717..3939751
Genome map
AA seq 344 aa AA seqDB search
MSRTETGKRTMYYGKGDVLVYRTFAEPLTEVTRIPESPFTGDGNVIMAMNVKVAVRGEAF
LTSFTEGDNSMVVATDSMKNLIIRHAADYEGSTVEGFLYHIAGIFLKKYSHITTIELEAD
RLPFDGLSVASPDGGWRESGLVFRRSHNDHTSASVVVERAEGGVLTVRKQESLLTGLQLI
KVKGSSFAGFIRDEYTTLPETQDRPLFIWLNIGWTYKDEKDAIDPKNGSYAASEQIRDIA
HTVFHEANSPSIQHLIYRIGLRILERFPQLAEVRFESNNRTWETVVESVDGSDARVYTEP
RPPYGFQGFSMTQEDLAAAAGGEDGEAAAALETAASERSEAPTS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacggaaacgggcaaacgcacgatgtactatggaaaaggggatgtgctcgtc
taccgcacgttcgccgagccgctgaccgaggttacacgcattccggagtcgccgttcacg
ggggacggcaatgtcattatggcaatgaatgtcaaggtggcggtccggggggaggcgttc
ctgacctcgttcaccgaaggggacaattcgatggtcgtggccaccgattcgatgaaaaat
ctgatcatccgccacgccgccgactacgagggcagcaccgtcgaaggattcctgtaccac
atcgcgggcatcttcctgaagaagtattcgcatatcaccactattgaactggaagcggac
cgcctgcccttcgacggcctgagcgtggcttcgcccgacggaggctggagggagagcggc
ctcgtcttccgccggtcgcacaatgaccatacgtcggcttccgttgttgtggagcgtgcg
gagggcggagtcctcacggtgcggaagcaggagagcctgctgacgggtctgcagctcatc
aaggtcaaaggcagctccttcgccggcttcatccgcgacgagtacacgaccctgccggag
acgcaggaccgtccgctctttatctggctgaacatcggatggacgtataaggacgagaag
gatgcgatcgatccgaagaacggaagctacgccgcatcggagcagatccgggatattgcg
cacacggtgttccatgaagcgaactccccgtcgattcagcatctgatctaccggatcggg
ctgcgcatcctggagcggttcccgcagctggccgaggtgcgcttcgagtcgaacaaccgg
acctgggagacggtggtggagagtgtggacggctcggacgcaagagtctatacggagccg
cgcccgccgtacggcttccagggcttctcgatgacgcaggaggacctggccgccgccgca
gggggagaggacggcgaggcggcagcggcgctcgagaccgcagcatcggagcgttcggag
gctcccacctcatga

DBGET integrated database retrieval system