KEGG   Paenibacillus mucilaginosus 3016: PM3016_3470Help
Entry
PM3016_3470       CDS       T01757                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PM3016_3470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_3470
   00020 Citrate cycle (TCA cycle)
    PM3016_3470
   00620 Pyruvate metabolism
    PM3016_3470
   00640 Propanoate metabolism
    PM3016_3470
   00650 Butanoate metabolism
    PM3016_3470
  Energy metabolism
   00680 Methane metabolism
    PM3016_3470
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PM3016_3470
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PM3016_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3949364..3950377
Genome map
AA seq 337 aa AA seqDB search
MRVLPKTNDLGFFEIRLESIGGLGANLAGKMLAEAGVVGSGFNGVSFSSYGSEKKGSPVK
AHIRFCDLNTNIRDTTPVERPHVVGVFHENLSKTVNVISGMYEDSLVLVNSPKSPAELKE
KLKLVGGTIAVVDATGIALEEKNRVNMAMLGGLFRLCEFLDFEHMKGIIRKSLEKKYPGA
VEPALRTFQRGYDEVQFQTFSLPEGLEMPMPKRWDIPVYGYETQAIGGMVSNPGNSILKD
LSISRSGMMPHFDEEKCIHCAACDTACPDFCFVWDEASDKKGRPQMFLQGIDYQYCKGCL
KCVVACPTEALTSNRETDGYGEAHRIPHRFRLAAKSV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttaccgaaaacgaatgacctcggtttcttcgaaatccgactcgagtccatc
ggcggcctgggtgcaaacctggcaggcaaaatgctggccgaagcgggcgtcgtcgggagc
gggtttaacggtgtcagcttctcttcctacgggtccgagaaaaagggatcgcccgttaag
gcacatatccggttctgtgatctgaacacgaacatccgggacacgacgcccgtggagcgg
ccgcatgtcgttggcgtgttccacgagaatctgtcgaagaccgtgaacgtgatcagcggc
atgtatgaggacagtctcgtgctcgtcaactcgcccaagagtccggcggagctgaaggag
aagctgaagctggtcggcggtacgatcgccgtggtcgatgcaacgggcatcgcgctcgag
gagaagaaccgggtcaacatggccatgctcggcggtctgtttcggctctgtgagttcctt
gattttgaacacatgaaaggcatcatccgcaagtccctggagaaaaaataccccggcgcc
gtcgagcccgccctgcggacgttccagcgcggatacgatgaagtgcagttccagaccttc
tcgctgcccgaaggcctcgagatgccgatgccgaagcggtgggatatcccggtatacggc
tatgagacgcaggcgatcggcgggatggtgtccaaccccggcaactcgatcctcaaagac
ctgagcatctcgcgcagcgggatgatgcctcacttcgatgaagaaaaatgcattcactgc
gccgcctgtgatacggcctgtcccgacttctgcttcgtatgggacgaggcctccgacaag
aaaggccgtccgcagatgttcctgcagggcattgactaccagtactgcaagggctgtctg
aagtgtgtggtggcctgtccgactgaagcgcttacatccaatcgggagacggacggctat
ggggaagcccaccgcattccgcaccggttccggctcgcagcgaagtccgtataa

DBGET integrated database retrieval system