KEGG   Paenibacillus mucilaginosus 3016: PM3016_3745Help
Entry
PM3016_3745       CDS       T01757                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmq01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmq00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4291903..4293309)
Genome map
AA seq 468 aa AA seqDB search
MEINWLAEVEKRKGDLLKDLEGLLRIASVKDLTTSTPEYPMGEKIGEALDYVLALAQNEG
FTTKNLDGFAGFAEWGESEEYIGVLAHVDVVPAPGEWTTPPYEPTVREGKLYARGAIDDK
GPGMAAFYALKILKDLGLPLKRKIRMIYGTDEESGMGCVKHYLDVEPEPTYGFSPDDVFP
MVYAEKGQINVKLTLSGSEEEQHGTILVNFSSGDRGNMVPGQAAAEMKTNQPEELMNRFK
TYCKEQALHGEVSKSDETITLTLYGTTVHGMEPQNGVNAGLECLHFLNTLSFAGRDQSFI
TFADNCLYRDPFGEKLGIQYSEDVLGPLTVNAGIFKYNHADGGTIQLNIRVPLNNDTQHT
IEMITKKAETCHFTIADAQQFPTHYIPADQPMIKTLQSAYQSITGDEPTLVTSGGATYAT
LMKNAVAYGALFPGKVDSSHQIDEFIEIDDLIKATAIYAKALYDLSHL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaattggctggcagaagtggaaaaaagaaaaggtgatcttttaaaggacttg
gaaggcttattgcgtattgcgagtgttaaggatttaacaacgagtactcccgaatatcca
atgggggaaaagattggcgaagcattggattatgttttggcattagcccagaatgagggg
tttacaactaaaaacttagacggctttgccgggtttgctgaatggggagagtctgaagaa
tatattggggtacttgcccatgtcgacgtggttccagctcccggagagtggacaacgcca
ccttatgagccaactgttcgagaaggaaagctctatgcccgcggtgccattgatgataaa
ggaccgggaatggctgcattttatgcgttgaagatattgaaggaccttggccttccttta
aaaaggaagatccgtatgatctatggcacagatgaggaaagtggtatgggctgtgtgaaa
cattatcttgacgtagagcccgagccaacttacggtttttctcctgatgatgtatttccg
atggtgtatgccgaaaaagggcaaattaatgtgaaactgactttaagtggcagtgaagaa
gaacaacacggaactattttagttaacttttcctcaggtgacaggggaaacatggtacct
ggacaagccgctgctgaaatgaaaacgaatcaacctgaggaacttatgaatcgttttaaa
acctattgtaaggaacaggcgctgcacggtgaggtcagcaagtccgatgaaacgattact
ttaaccctttacggtacaaccgtgcatggtatggaaccccaaaatggagtgaatgccgga
ctggagtgcctgcatttcttaaacacattaagttttgcgggtagggaccaatcattcatc
acatttgccgataactgcctatatagagatccttttggggaaaagctgggaatccaatac
agtgaagatgtgctcggacctttaacggtcaatgccggcattttcaaatacaatcatgca
gatggcggtaccattcagttgaacattcgcgttcccttaaataatgatacccaacatacc
attgaaatgatcacgaaaaaagcggagacctgccattttacaatcgccgatgcacagcag
ttccctacacattatatccctgccgatcaacctatgattaaaacattgcagtcggcttat
caatcgattacaggggatgaacccacacttgtaacatcgggcggggcgacgtatgcgacg
ttaatgaaaaatgcggtggcttacggtgcgcttttccctggcaaggtagatagctctcac
caaattgatgaatttatagaaatcgatgatttaatcaaagcgacagccatctacgccaaa
gcattatatgatttaagccacttataa

DBGET integrated database retrieval system