KEGG   Paenibacillus mucilaginosus 3016: PM3016_4109Help
Entry
PM3016_4109       CDS       T01757                                 

Definition
protein FucI
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4850341..4852134)
Genome map
AA seq 597 aa AA seqDB search
MTKVHTANRLQGSMPKIAIRPVIDGRRGGIRESLEEVTMELARAVSGLLSARLRHANGLP
VECVIADTCIGGVAEAAAAEEKFAREGAGVSITVTPSWCYPTETMDTDPFRPKAVWGFNG
TERPGAVYLAAVLAAHNQAGLPAFGIYGRDVQDMGDTSIPDDVQEKLLRFAKAGLAAATM
RGKSYLSMGSVSMGIAGCIADEPFFRRYLGMRNEYVDMSEFIRRMEREIYDPEEFVRALE
WTRTHCREGEDVNPPALRRSRSQKDADWETVVKMALIARDLMVGNPALDRLGYGEEALGR
NAIAAGFQGQRAWTDHYPNGDFMEAVLTSSFDWNGIREPYMLATENDTLNGVTMLFGHLL
TDAAQIFADVRTYWSPDAVKRVTGYELQGSTAHGLIHLINSGPAALDGTGRMRKDGLPVM
KPFWEITEEEVQACLEAVQWCPAVDFFRGGGFSTDYTTSAGMPVTMARINLVHGLGPVLQ
LAEGVTVELPDEVHRKLDERSNPTWPTTWFAPNLTGTGAFRDVYTVMNHWGSNHAAVSCG
HIGADLITLASILRIPVAMHNVPSERLLRPSAWGAFGTEDTTGADFRACANFGPLYG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtacatacagccaaccgcctgcagggaagcatgccgaaaatcgcgatccgg
ccggtcatcgacggccggcggggaggcatccgcgaatcgctggaggaggtgacgatggag
ctggcccgcgccgtgtccggtctgctctccgcccggctccggcacgcgaacgggcttcct
gtggagtgcgtcatcgccgacacctgcatcgggggcgtcgcggaagccgccgcggcagag
gagaaatttgcccgcgaaggagcgggagtctccatcacggtgacgccttcatggtgttat
ccgaccgaaacgatggatacggacccgttccggccgaaggcggtctggggcttcaacggg
acggagcgccccggagccgtgtatctcgccgccgttctggccgcgcataaccaggccggg
ctgccggccttcggcatctacggccgcgacgtgcaggacatgggcgacacgtcgatcccg
gacgacgtgcaggagaagctgctgcgcttcgccaaggcggggcttgccgcggccaccatg
cgcggcaagtcgtatctgtccatgggctcggtgtcgatggggatcgccggctgcattgcc
gatgagccctttttccggcggtatctcggcatgcgcaacgaatacgtcgatatgagtgag
ttcatccggcggatggagcgggagatctacgacccggaggagttcgtgagagccctggag
tggactcgtacgcactgccgggaaggggaggatgtgaaccctcccgccctgcggcgcagc
cgcagccagaaggacgccgattgggagaccgtcgtgaagatggcgctcatcgcccgcgac
ctgatggtcggcaacccggcgcttgaccggctcggctacggcgaggaggcgcttggccgc
aatgcgattgccgccggcttccagggccagcgggcatggacggatcattatccgaacggg
gacttcatggaggcggtgctgacgagctccttcgactggaacggcatccgggagccgtat
atgctggccacggagaacgacaccctgaacggcgtcacgatgctcttcggccatctgctg
acggatgccgcccagatcttcgccgatgtaaggacgtattggagcccggatgccgtgaag
cgcgtgacaggttatgaacttcagggcagcaccgcgcacggcctcatccacctcatcaat
tcgggcccggcggcgctggacggaacgggcaggatgcggaaggacggactcccggttatg
aagccgttctgggagattacggaggaggaggtgcaggcctgcctggaggccgtgcagtgg
tgccccgccgtcgacttcttccggggcggcggcttctccacggattatacgacgtcagcc
ggcatgccggtaaccatggcgcgcatcaacctggtgcacggccttggtcccgtactgcag
ctggccgagggcgtcacggtcgagctgccggatgaggtgcaccggaagctcgacgagcgg
agcaacccgacctggccgacgacctggttcgccccgaacctgacgggcacaggtgccttc
cgcgatgtgtatacggtcatgaaccactggggctcgaaccacgcggcggtcagctgcggg
catatcggagcggatctcatcacgctggcctccatcctccggattccggtggcgatgcac
aacgttccgtccgagcggctgctgcggcccagcgcctggggagccttcggcacggaggac
acaacgggcgccgacttccgggcctgcgcgaatttcggcccgttgtacgggtaa

DBGET integrated database retrieval system