KEGG   Paenibacillus mucilaginosus 3016: PM3016_4435Help
Entry
PM3016_4435       CDS       T01757                                 

Definition
xylanase B
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pmq  Paenibacillus mucilaginosus 3016
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5269611..5270567
Genome map
AA seq 318 aa AA seqDB search
MFKSKLAKLCASSLLVGSILSFTLIPSADAGLARSKFLGNIIAGSVPSNFATYWNQVTPE
NSTKWGSVEATRNRMNWTAADTAYNYARSSGFPFKFHTLIWGSQEPGWIGSLSAADQKAE
VLQWIQASASKYPNAAFVDVVNEPLHAKPSYRNAIGGDGATGWDWVIWSFQEARKAFPNS
KLLLNEYGIISDPNAAAAYVQIANLLKSRGLIDGIGIQCHQFNMDTVSVSTMRNVLNTLA
STGLPIYVSELDMTGDDATQLARYKEKFPVLWEHTAVKGVTLWGYIEGQTWKANTHLITS
SGTERPALKWLRDYLAAH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatccaagctagccaagctgtgtgcctcttccctgcttgttggctccatcctg
tccttcacactcatccccagcgccgatgcgggactggcgcgcagcaagttccttggcaac
attattgcaggcagcgtgccttcgaacttcgccacgtattggaatcaggtgacgcccgag
aattcgacgaagtggggctcggtcgaagcgacccggaaccggatgaactggaccgctgcc
gataccgcttacaattatgcgcgcagcagcggcttcccgttcaaattccatacgctcatc
tggggcagccaggagccgggctggatcggcagcctctccgccgccgaccagaaagccgaa
gtgctgcagtggattcaggcttccgccagcaaatatccgaatgccgccttcgtcgatgtc
gtgaacgagcctctacatgccaagccgtcctaccgcaatgcgattggcggcgacggcgcg
acgggctgggactgggtgatctggtccttccaggaagcgcggaaggcattcccgaattcc
aagctgctgctcaatgaatacggcattatcagcgacccgaatgcggcggccgcttacgtc
cagattgccaatctgctgaagagccgggggttgatcgatgggattggcattcaatgccat
cagttcaatatggacaccgtctccgtcagcacgatgagaaacgttctgaatacgcttgct
tccaccggcctcccgatctatgtctccgagctggatatgaccggcgacgatgcgacccag
ctcgcgcgctacaaggagaagttccctgtgctctgggagcatacggccgtgaagggtgtg
accctgtgggggtacatcgaaggccagacgtggaaggccaacacgcaccttatcacgagc
tcgggcacggagcgtcctgccctcaagtggctccgggactatctggcagcgcattga

DBGET integrated database retrieval system