KEGG   Paenibacillus mucilaginosus 3016: PM3016_4552Help
Entry
PM3016_4552       CDS       T01757                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PM3016_4552
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PM3016_4552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5480466..5481920
Genome map
AA seq 484 aa AA seqDB search
MRNMPNHIVVIGGGITGLTAAYELNKRAARENRPLRVTLIEREPRLGGAVRTLRQDGFVI
EQGPDSFLSRKPETLLLARELGLEEQLVGLNPDAARSYMYRNGRLQPLPEGLSMGIPTRV
LPFLGTGLLSYRAKARAALDLVLPRRTALGDEPLGGLIGRRMGREVADGLVGPILAGIYA
GDVHKLSTAATFPQLLSLESRHRSLILGMLASKRMPKSPVHGRTGPELPPRLRGSLFLTF
SSGLGALVERLTEELVCQGTVIRQETSASAISPAGESGSAYRVTLSDGAELHADAVILAV
PAHTAAMLLKGRSRSLNRCLASIQGVSVANVALGLDGRRLRAPLRGSGFVAPRGSGLRIT
ACTWTSVKWPHTAPPGKLLLRAYLGHAGDEIHCGHGDDALTAAVLEDLGRILGEELRPDF
SVVSRHPAAMPQYECGHLERLHGMESELLAQWPNVVLAGKSYRGTGMPDCIRQGMDAAEK
IRLR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacatgcctaatcatatcgtcgtgatcggaggcggcatcaccggattaacggcc
gcctatgaattgaacaagcgtgccgccagagagaaccggccgctccgggtaaccttgatc
gaacgggagccccgtctggggggcgcggtccggacgctgcggcaggacggattcgtgatc
gagcaaggccccgactccttcctgtccagaaagcccgagacgctccttctggcccgggag
ctcggcctggaggaacagctggtggggctcaatcccgatgcggcccgcagctatatgtac
cggaacggccggctgcagcctctgcccgaagggctgtcaatgggcatccccacccgggtt
ctgccgttcctcggaaccgggctgctctcgtacagggccaaagcgcgcgccgcgctggat
ctggtgctcccccgccggacggcgcttggagacgagccgctgggcgggctgatcggcagg
cgcatgggccgggaagtggctgacggcctcgtgggccccatcctggccggcatctatgcc
ggcgacgtgcacaagctgagcacggccgcgaccttcccccagctgctctccctggaatcc
cgccaccgcagtctcattctcggcatgctggcatccaagcgcatgccgaaaagccccgtg
cacggccgcacgggacctgagcttccgccccggctgcggggcagcctgttcctcaccttc
agctcggggctcggcgccttggtggaacgtctgacggaagaactggtctgccagggcacc
gtcatccggcaggagacttccgcgtcggccatcagccccgcaggggagtccgggagcgcc
taccgcgtgaccttgtcggacggagccgagcttcatgccgatgcggtcatcctggcggtt
cccgcccatacggcagccatgcttctaaaaggccgttcccgttccctgaaccggtgcctg
gcctccatccagggtgtctccgtcgccaatgtggccctcggcctcgacggccgcaggctt
cgcgctcccctgcgcgggtcgggcttcgtcgctccccgcggcagcggtctccggattacg
gcctgcacctggacatcggtcaagtggccccataccgctccgcccggcaagctcctgctc
cgtgcctatcttgggcatgcaggcgatgaaatccactgtgggcacggtgacgacgccctg
acggcagcggtcctggaggacctcggccgcattctcggtgaagagctccggccggatttc
agcgtggtgtccaggcatccggccgcgatgccccagtatgaatgcggccacctggagcgg
ctgcacggcatggaatccgagctgctggcgcagtggccgaatgtcgtccttgccggcaaa
tcctacagggggacgggcatgcccgactgcatccggcaggggatggacgcggcggagaag
atccggctgagataa

DBGET integrated database retrieval system