KEGG   Paenibacillus mucilaginosus 3016: PM3016_4626Help
Entry
PM3016_4626       CDS       T01757                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5582551..5583960)
Genome map
AA seq 469 aa AA seqDB search
MRTIAVIGGGITGLSAAYHLQKNRNAVQEELRIVVIEAAGMLGGKISTHQDGGFLMETGA
DSIVTRKMNAGGLIEELGLGGEVVYNATGRSYIHVDGELKPIPDDTVFGIPMSLESLAKS
TLVSAEGKVEALRDWYTPNETFTKNDTVGSFLEHFLGKELVDKQIAPVLSGVYSGDLADL
TIASTLPYLIEYKNEYGSIIRGLSENKAKFKGTGGAKFMSFSGGMSVLIDGLERRLLEGG
AEIRKGIRTERLVRDGDRYRLTLADGSELEAHDVILSIPHDAAQALLRDEVLDADFDRFK
NSSLISVYMGFDIPDARLPADGTGFIASRHSELVCNACTWTSRKWEHTSAGRQLLVRLFY
KSSKPDYERLVRMTEQELLEVALEDMRMSLGLSGQPVAYNVRKWEESMPNYHTRHPAVVK
SLVSQTAERYPGLFLAGCSYYGVGIPDCIESGEAAARQILERIGRGAAV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacgatagctgtcatcggcgggggcattacaggcctgtccgccgcttatcatttg
caaaaaaacaggaatgccgtacaggaggagctccggatcgtcgtcatcgaagcggcaggc
atgctgggaggcaagatcagcactcatcaggacggcggcttccttatggagacgggggcc
gattcgatcgtcacgcgcaagatgaacgcgggaggcctgatcgaagagctgggcctgggc
ggcgaggtggtctataacgcgacaggccggtcctacatccacgtggacggcgagctgaag
ccgatcccggacgacacggtcttcggcattccgatgagcctggagtcgctggcgaagagc
acgctggtgtccgccgaaggcaaggtggaggcgctgagggactggtatacgcccaatgag
acattcaccaagaacgacacggtcggcagcttcctggagcattttctcgggaaggagctt
gtggacaagcagatcgcgccggtcctctcgggcgtatattcgggagacctggccgatctg
acgatcgcctccacgctgccgtatctcatcgagtacaagaacgaatacggcagcatcatc
cgcggcctgtccgagaacaaggcgaagttcaaggggacggggggcgcgaagttcatgtcc
ttcagcgggggcatgtcggtcctgatcgacgggctggagcggcgcctgctggaggggggc
gccgagatccgcaagggcatccggaccgaacgtcttgtccgggacggggaccggtaccgg
ctgaccctggcggacgggagcgagcttgaggcgcacgacgtcattctgagcattccgcat
gatgcggcgcaggccctgctgcgggatgaggtgctggatgcggattttgaccgattcaaa
aacagctcgctgatctccgtgtacatgggcttcgacatcccggacgcccgcctgccggcc
gacggcaccgggttcatcgcttcccggcacagcgagctggtctgcaacgcctgcacctgg
accagccgcaagtgggagcatacgtccgcaggccggcagctgctggtgaggctgttctac
aagagctcgaagccggactacgaacggctcgtgcggatgacggagcaggagctgctcgag
gtggccctggaggatatgcgcatgagcctcggcctctccggacagccggtggcttacaac
gtgcggaaatgggaggaaagcatgccgaattaccatacccggcaccccgccgtcgtgaag
tcgctggtgagccaaacggccgagcggtacccggggctgtttctggccggctgctcgtac
tacggcgtcggcatcccggactgcatcgagagcggtgaagctgccgcccgtcagattctt
gagcggatcggccgcggagccgccgtataa

DBGET integrated database retrieval system