KEGG   Paenibacillus mucilaginosus 3016: PM3016_5121Help
Entry
PM3016_5121       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PM3016_5121
Enzymes [BR:pmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PM3016_5121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6147031..6148302)
Genome map
AA seq 423 aa AA seqDB search
MKKISILGSTGSIGTQTLDVVSHYPELYSVEGLAGGHNLPLLQQQIERFRPRKVSVATPE
LAQELARQVPAGVQVYSGPEGLTEIAAGTDAELVVTAVVGSQGLHPTLAAIEAGKHIGLA
NKETLVSGGHLVTEAARRKGVSLLPIDSEHSAIFQCLNGESMEDIHKITLTASGGSFRDR
TREQLVGVTVQDALNHPNWSMGAKVTIDSATMVNKGLEVMEAHWLFGLSYDRIDVLIHPE
SIIHSFVEFEDYSIIAQLGMPDMRVPIQYALTYPRRMKTPSERLRLSEIGRLNFRAMDFD
RFPCLRMAYDSGRAGGSMPTVFNAANEVAVERFLQGEIAFLDIERIIEEAMSRHDTIPDP
DLDTITEIDQWPERRLAERPDGRLGFEGRHFLAAVNIYVRRQTCMGQGKRQEAGGLEVLP
GCG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatcagtattctgggctcgaccggatcgatcggcacccagacgcttgatgta
gtatcgcattacccggagctgtattcggtggaagggttggcgggcggccacaatctgccc
ctgctgcagcagcagatcgaacgcttccggcctcggaaggtgtcggtagccaccccggag
ctggcgcaggagcttgcacgacaggtgccggcaggcgtgcaggtgtattccggaccggaa
gggctgaccgagattgcggccggcaccgacgcggagctggtggttaccgccgtagtcgga
agccaggggcttcacccgacgctcgcggcgatcgaggccggcaagcacatcggtcttgcc
aataaggagacgctggtgagcggcgggcatctggtgacggaggcggcacggcgcaagggt
gtcagcctgctgccgatcgacagcgagcattcggcgattttccagtgcctgaacggggaa
tcgatggaagacatacataaaatcaccctgacggcatcgggcggctcgttccgtgaccgc
actcgcgaacagctcgtcggtgtcacggtgcaggatgcgctgaaccatccgaactggtcg
atgggcgcgaaggtgacgatcgactcggccaccatggtgaacaaggggcttgaggtcatg
gaagcgcactggctgttcgggctctcatatgaccggattgacgtgctgatccatccggag
agcatcatccactccttcgtggaattcgaggattacagcatcatcgcccagctgggcatg
ccggatatgcgggtgccgatccagtacgcgctgacgtatccccggaggatgaagacgcct
tcggagaggctgcgcctgtccgagatcgggcggctgaacttccgggcgatggactttgac
cggttcccctgcctgcggatggcttatgacagcggacgtgcggggggctcgatgcctacc
gtctttaacgcggccaacgaggttgcggtggaacgcttcctgcagggggaaattgcattc
cttgatatcgaacggattatcgaggaggccatgagccggcacgacaccatcccggatccg
gatctggataccatcacggagatcgaccagtggccagagagacggctcgcggagcggcca
gacggtaggctgggctttgagggaagacattttttggctgcggtgaacatatatgttcgt
aggcagacatgcatggggcaggggaagcggcaggaggcagggggcctggaggtcttgccc
ggctgcgggtag

DBGET integrated database retrieval system