KEGG   Paenibacillus mucilaginosus 3016: PM3016_5121Help
Entry
PM3016_5121       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6147031..6148302)
Genome map
AA seq 423 aa AA seqDB search
MKKISILGSTGSIGTQTLDVVSHYPELYSVEGLAGGHNLPLLQQQIERFRPRKVSVATPE
LAQELARQVPAGVQVYSGPEGLTEIAAGTDAELVVTAVVGSQGLHPTLAAIEAGKHIGLA
NKETLVSGGHLVTEAARRKGVSLLPIDSEHSAIFQCLNGESMEDIHKITLTASGGSFRDR
TREQLVGVTVQDALNHPNWSMGAKVTIDSATMVNKGLEVMEAHWLFGLSYDRIDVLIHPE
SIIHSFVEFEDYSIIAQLGMPDMRVPIQYALTYPRRMKTPSERLRLSEIGRLNFRAMDFD
RFPCLRMAYDSGRAGGSMPTVFNAANEVAVERFLQGEIAFLDIERIIEEAMSRHDTIPDP
DLDTITEIDQWPERRLAERPDGRLGFEGRHFLAAVNIYVRRQTCMGQGKRQEAGGLEVLP
GCG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatcagtattctgggctcgaccggatcgatcggcacccagacgcttgatgta
gtatcgcattacccggagctgtattcggtggaagggttggcgggcggccacaatctgccc
ctgctgcagcagcagatcgaacgcttccggcctcggaaggtgtcggtagccaccccggag
ctggcgcaggagcttgcacgacaggtgccggcaggcgtgcaggtgtattccggaccggaa
gggctgaccgagattgcggccggcaccgacgcggagctggtggttaccgccgtagtcgga
agccaggggcttcacccgacgctcgcggcgatcgaggccggcaagcacatcggtcttgcc
aataaggagacgctggtgagcggcgggcatctggtgacggaggcggcacggcgcaagggt
gtcagcctgctgccgatcgacagcgagcattcggcgattttccagtgcctgaacggggaa
tcgatggaagacatacataaaatcaccctgacggcatcgggcggctcgttccgtgaccgc
actcgcgaacagctcgtcggtgtcacggtgcaggatgcgctgaaccatccgaactggtcg
atgggcgcgaaggtgacgatcgactcggccaccatggtgaacaaggggcttgaggtcatg
gaagcgcactggctgttcgggctctcatatgaccggattgacgtgctgatccatccggag
agcatcatccactccttcgtggaattcgaggattacagcatcatcgcccagctgggcatg
ccggatatgcgggtgccgatccagtacgcgctgacgtatccccggaggatgaagacgcct
tcggagaggctgcgcctgtccgagatcgggcggctgaacttccgggcgatggactttgac
cggttcccctgcctgcggatggcttatgacagcggacgtgcggggggctcgatgcctacc
gtctttaacgcggccaacgaggttgcggtggaacgcttcctgcagggggaaattgcattc
cttgatatcgaacggattatcgaggaggccatgagccggcacgacaccatcccggatccg
gatctggataccatcacggagatcgaccagtggccagagagacggctcgcggagcggcca
gacggtaggctgggctttgagggaagacattttttggctgcggtgaacatatatgttcgt
aggcagacatgcatggggcaggggaagcggcaggaggcagggggcctggaggtcttgccc
ggctgcgggtag

DBGET integrated database retrieval system