KEGG   Paenibacillus mucilaginosus 3016: PM3016_5250Help
Entry
PM3016_5250       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PM3016_5250
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PM3016_5250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6274348..6274989)
Genome map
AA seq 213 aa AA seqDB search
MTSNYSDTPVDKGILIVLSGPSGVGKGTVCKALRECAPDIVYSVSATTRSPREGEVDGVN
YFFKTREQFQQLIEQDQMLEWAEYVGNYYGTPRKFVEDTLNSGKDIILEIEVQGALKVKQ
KFPEGVFLFLLPPSLTELESRIVGRGTEPEDVIRSRMSVAVDEIAMMEHYDYAIVNDQVD
SACSRIRSILTAEHCRKDRMIAKIQHWMAEVRK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtaattacagcgataccccggtggacaaagggattctgattgtgctgtcgggc
ccatcgggcgtaggcaagggaacggtttgcaaggcgcttcgggaatgtgctcccgatatc
gtttactccgtatcggcaaccacgcgcagcccgcgcgagggggaagtcgacggggtgaat
tatttcttcaagacccgggaacaattccagcagctcatcgagcaggaccagatgttggaa
tgggccgaatatgtgggtaattactacggtactccgcgcaaattcgtggaagatacgctg
aacagcggcaaggacattatcctcgagatcgaagtgcagggtgcgctgaaggtcaagcag
aagttccccgaaggggtgttcctgttcctgctgccgccgtcgctcaccgagctggagagc
cggattgtcggacggggcacggagcccgaggacgtcatccgcagccggatgtccgttgcc
gtagacgagattgcgatgatggagcactacgattacgccatcgtgaacgatcaagtcgat
tcggcctgttcgcggatccggagtattctgacggccgagcactgccgcaaggaccggatg
attgccaagattcaacattggatggcggaggtgagaaaataa

DBGET integrated database retrieval system