KEGG   Paenibacillus mucilaginosus 3016: PM3016_5340Help
Entry
PM3016_5340       CDS       T01757                                 

Definition
protein RocF
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PM3016_5340
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PM3016_5340
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PM3016_5340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6373445..6374359
Genome map
AA seq 304 aa AA seqDB search
MSAVKDISVLCVPFDLGAGRKGVRLGPHAILQAGLERRLRGLGLQVEVLQPFPVPQAGIS
EPAVRTEEALLHLDEVAGLNELLAQAVWGILGRGRFPLVLGGDHSIAIGTLAGIAPHLKN
PGVIWFDAHSDLNTPETSPSGNIHGMSLAAALGLGHDRLVRIGGITPKIKPEHTVIIGAR
SLDPGEKERIRSLGIRCFTMHEIDRMGISRVMEEALHIAGAGTDGIHVSFDIDSMDPGEA
PGTGTPVRGGLSYREAHCALEMLSESGLVRSAEVVEVNPVLDTDNKTARLAAELMGSLLG
QRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtaaaggacatctctgtcctgtgtgtcccctttgatcttggggccggacgc
aagggcgtacgcctcgggccgcatgccatcctccaagccggactcgaacgccggctgcgc
gggctgggcctccaggtggaggtgctgcagccgttccctgtaccgcaggccggcatatcc
gagcccgccgtccggacggaagaggccctgctccacctggatgaggtcgccggactgaac
gagctgctggcccaggccgtctggggcattctcgggcggggacggttcccgctcgtgctc
ggcggagaccacagcatcgccatcggcacgctcgccggcatcgcgccgcacctcaagaac
cccggtgtgatctggttcgacgcccattcggatctcaatacccccgagaccagtccgtcc
ggcaacatccacggcatgtcccttgcggccgctctcggccttgggcatgaccggctcgtg
cggatcggcgggattaccccgaagatcaaaccggagcacacggtcatcatcggtgccagg
tcgctcgatcccggggagaaggagagaatccggtcgctgggcatccgctgcttcacgatg
cacgagatcgacaggatggggatctcccgcgtcatggaagaagccctgcacatcgcaggt
gccggaacggacggcatccacgtctccttcgacatcgacagcatggaccccggcgaagcc
cccggcaccggcacccccgtacgcggaggactcagctaccgcgaagcgcactgcgcgctc
gagatgctgtccgaatcgggcctggtccgctcggccgaggtcgtggaagtgaatccggtg
ctcgataccgacaataaaaccgcccggctggcggccgaactcatgggctcgctgctcggc
cagcgaatcttatag

DBGET integrated database retrieval system