KEGG   Paenibacillus mucilaginosus 3016: PM3016_5340Help
Entry
PM3016_5340       CDS       T01757                                 

Definition
(GenBank) RocF
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00220  Arginine biosynthesis
pmq00330  Arginine and proline metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01130  Biosynthesis of antibiotics
pmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PM3016_5340
   00330 Arginine and proline metabolism
    PM3016_5340
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PM3016_5340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFC32043
UniProt: H6NB75
Position
6373445..6374359
Genome map
AA seq 304 aa AA seqDB search
MSAVKDISVLCVPFDLGAGRKGVRLGPHAILQAGLERRLRGLGLQVEVLQPFPVPQAGIS
EPAVRTEEALLHLDEVAGLNELLAQAVWGILGRGRFPLVLGGDHSIAIGTLAGIAPHLKN
PGVIWFDAHSDLNTPETSPSGNIHGMSLAAALGLGHDRLVRIGGITPKIKPEHTVIIGAR
SLDPGEKERIRSLGIRCFTMHEIDRMGISRVMEEALHIAGAGTDGIHVSFDIDSMDPGEA
PGTGTPVRGGLSYREAHCALEMLSESGLVRSAEVVEVNPVLDTDNKTARLAAELMGSLLG
QRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagtaaaggacatctctgtcctgtgtgtcccctttgatcttggggccggacgc
aagggcgtacgcctcgggccgcatgccatcctccaagccggactcgaacgccggctgcgc
gggctgggcctccaggtggaggtgctgcagccgttccctgtaccgcaggccggcatatcc
gagcccgccgtccggacggaagaggccctgctccacctggatgaggtcgccggactgaac
gagctgctggcccaggccgtctggggcattctcgggcggggacggttcccgctcgtgctc
ggcggagaccacagcatcgccatcggcacgctcgccggcatcgcgccgcacctcaagaac
cccggtgtgatctggttcgacgcccattcggatctcaatacccccgagaccagtccgtcc
ggcaacatccacggcatgtcccttgcggccgctctcggccttgggcatgaccggctcgtg
cggatcggcgggattaccccgaagatcaaaccggagcacacggtcatcatcggtgccagg
tcgctcgatcccggggagaaggagagaatccggtcgctgggcatccgctgcttcacgatg
cacgagatcgacaggatggggatctcccgcgtcatggaagaagccctgcacatcgcaggt
gccggaacggacggcatccacgtctccttcgacatcgacagcatggaccccggcgaagcc
cccggcaccggcacccccgtacgcggaggactcagctaccgcgaagcgcactgcgcgctc
gagatgctgtccgaatcgggcctggtccgctcggccgaggtcgtggaagtgaatccggtg
ctcgataccgacaataaaaccgcccggctggcggccgaactcatgggctcgctgctcggc
cagcgaatcttatag

DBGET integrated database retrieval system