KEGG   Paenibacillus mucilaginosus 3016: PM3016_5409Help
Entry
PM3016_5409       CDS       T01757                                 

Definition
protein PyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PM3016_5409
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PM3016_5409
Enzymes [BR:pmq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PM3016_5409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6441592..6442500)
Genome map
AA seq 302 aa AA seqDB search
MTQLSVHTDKHLLGTKGMTAGELTSILDRAAYWEQYPVKVSNGLQGRFVANMFFENSTRT
RFSFEVAEKRLGAEVLNFAAAVSSVQKGESIYDTVRTIESMGVDAGVIRMKPNGLLAELA
QKIKFPLINAGDGNNEHPTQALLDLYTMRKQFGEIKGLNVAIIGDIQHSRVARSNLWALQ
ALGAKVSFCAPQGMQAAELAGHAPYVTIDEALKADVVMMLRVQLERHEGTLFGSAEEYRA
AYGLTVERAARMAPHAIIMHPAPVNRGVEIDDELVECEKSKIFQQMSHGVPIRMAVIERA
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacacagctcagcgtacacacagacaagcatctgcttggcaccaaaggcatgacggcc
ggcgaactgacgtccattctggatagagcggcatactgggaacagtatccggtgaaggta
tcgaacggcctgcagggccggtttgtagcgaatatgttcttcgagaacagcacgagaacg
cggttctccttcgaagtcgcggagaagcgcctcggggcggaggtgctgaacttcgccgcc
gccgtctcctcggtgcaaaaaggggagtcgatctacgatacggtccgcacgatcgaatcg
atgggcgtcgacgcgggcgtcatccggatgaagccgaacgggctgctcgccgagctcgcc
cagaagatcaagttcccgctgatcaacgcgggggacggcaacaacgagcatccgacgcag
gcgctgctcgatctctacacgatgcgcaagcagttcggcgagatcaagggcctgaacgtg
gcgatcatcggcgacatccagcacagccgggtggcccgctcgaacctgtgggcgctgcag
gcgctgggcgccaaagtaagcttctgtgcgccgcaggggatgcaggccgccgagctcgcc
ggccacgccccgtacgtgacgatcgacgaagcgctgaaggcggatgtggtcatgatgctg
cgcgtgcagctcgagcgccacgaaggcacgctcttcggctcggccgaggaataccgggcg
gcctacgggctgacggtggagcgggcggcgcgcatggcgccccacgcgatcatcatgcac
ccggctccggtgaaccggggcgtcgagatcgacgacgagctcgtcgagtgcgagaaatcg
aagattttccagcagatgagtcacggcgtaccgatccggatggccgtcatcgaacgggca
ctgagctaa

DBGET integrated database retrieval system