KEGG   Paenibacillus mucilaginosus 3016: PM3016_5505Help
Entry
PM3016_5505       CDS       T01757                                 

Definition
protein MurA2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmq00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmq00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6513644..6514912)
Genome map
AA seq 422 aa AA seqDB search
MEKLVIEGGKPLSGAIKIHGAKNAALPILAAGIMAEGTVVIENVPDLSDIHVMLGILQAL
GCQAEYQGDTVTVNTMGVHEFHIPEHLMSQMRSSIFLMGPLLARLGRVELYQPGGCAIGE
RKIDLHLRGLTALGAHIEESGSKIVCTAKELRGAEIVLDFPSVGATENIMMAAATARGST
TITGAAREPEIQDLQNFLNSMGAKIMGAGTDTITIEGVPVLTPGTYRIIPDRIVAGTLMI
AAAVTKGNITLEQVCPAHMTSAIHVLKRAGVQIAISGDIMNVCAPTRPKAVERIVTSPHP
AFPTDLQSQIMVLLSLADGVSVVKETVFEGRFKHVDELSRMGADIRVDLNAAMIRGVPRL
YGATVEATDLRAGAALVIAGLAAQGTTVIEQIHHIDRGYDRIESMLSALGASIHRVSPVP
SE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagttggttatcgaaggcgggaaacctctatcgggagccatcaagattcacgga
gccaaaaacgccgcactgcctatcctggcagccggcatcatggcggaaggcaccgtagtc
attgagaatgtgccggacttgtccgatattcacgtgatgctcgggattctgcaggccctc
ggctgtcaggcggaataccagggggatacggtgaccgtgaacacgatgggggttcatgaa
ttccacattccggagcacttgatgagccagatgcggtcttcgatcttccttatgggcccg
ctgctcgcacggctcggccgggtggagctgtatcagcctggagggtgcgcgatcggagag
cgaaagatcgatctgcatctgcgcggcctgacggccctcggtgcgcatatcgaggagagc
ggcagcaagattgtttgtacggccaaggaactgcggggggcggagatcgtactcgacttc
ccgagcgttggagccaccgagaatatcatgatggccgccgccacggcccggggttccacc
acgattacgggagcggcgcgcgagcccgagattcaggacctccagaacttcctgaattcc
atgggcgccaagattatgggggcggggacggacacgatcaccatcgagggtgtgccggta
ctgaccccgggcacctaccggatcatcccggaccggattgtcgccggaaccctcatgatc
gccgcagccgtcacgaaggggaacattacgctggagcaggtgtgtccggcgcatatgacc
tcggcgattcacgtgctgaagcgcgcaggtgttcaaatcgcaatcagtggtgatataatg
aacgtatgcgctcccacccgtcccaaagcggtggagcggatcgtgacatcgccgcacccg
gccttcccgaccgatctgcagtcgcagattatggtgctgctgagcctcgcagacggggta
agcgtagtgaaggaaacggtttttgaaggaagattcaagcacgtggatgaactctcccgc
atgggagccgacatccgggtggatctcaatgcggccatgatccggggcgttccccggctg
tacggggccacggtggaagccacggaccttcgtgcgggagcggctctggtgatcgccggc
cttgcagcgcaggggacgacggtgatcgaacagattcatcacatcgaccgcggttacgac
cggatcgagtctatgctgagtgcactcggcgcaagcattcacagggtatcaccggtacca
tcggagtaa

DBGET integrated database retrieval system