KEGG   Paenibacillus mucilaginosus 3016: PM3016_5512Help
Entry
PM3016_5512       CDS       T01757                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmq00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmq00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6522216..6523550)
Genome map
AA seq 444 aa AA seqDB search
MPPPPPAGGAALVAERELDAGVPVLLVKDARHAMAVLANHFYGYPSRELKLIGVTGTNGK
TTTTYLLDRVLSDAGYRTGLMGNIHIKIGGEYLPNHATNTQEALELQKILRQMADAGTDY
CLMEVSSHGLEMGRVKGCLFRSGIFTNLTQDHLDFHGTMERYQAAKGLLFSRLGNDYGAD
PAQRRFAVLNGDEEASSDYARLTAAETIVYGIDNPKADVRAEGIEMTAQGTRFQCVTYRG
TAEIRTRLVGRFNVYNVLGVIAAALAEGLELEGIAASLAGIASVEGRMEVVDAGQPFLVL
VDYAHTPDGLENALSTVSQFAEGSIYCVFGCGGDRDRAKRPLMGGVAAKYSDYIYVTSDN
PRTENPEAILQDIVPGIEQAGLDPASYELIADRKEAIRRAVERAQPGDIVLIAGKGHETY
QDIGGVKHPFDDRLVAKEAVMGRT
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgccgcccgccgggggcgccgccctggtggcggaaagggagctggacgcc
ggcgtgccggtgcttctggtgaaggacgcccgccatgcgatggcggtgcttgccaatcac
ttttacggctatccgagccgggagctgaagctcatcggcgtaacgggaacgaacgggaag
acgacgacgacctacctgctcgaccgcgttctgagcgatgcggggtaccgtacgggcctg
atgggcaacatccacatcaagatcggcggcgagtatctgccgaaccatgcgacgaatacc
caggaagcgctggagctgcagaagattctgcggcagatggcggatgccgggaccgattac
tgtctgatggaggtatcctcgcacggcctcgagatgggccgggtgaagggatgcctattc
cggtcgggcatttttaccaatttgacccaggatcacctggacttccacggaacgatggag
cgctatcaggccgccaagggcctgctgttctcccgcctgggcaacgactacggagcggat
ccggcacagcgccggttcgccgtgctgaacggggacgaggaagcctcctcggactacgcg
aggctgacggcggctgagacgatcgtctacggcatcgacaacccgaaggcggatgtgcgg
gccgaaggcattgaaatgacggcgcagggcacccggttccagtgtgtgacctaccggggg
acggcggagatccggacgcgtctggtcggacgatttaacgtgtacaacgtgctgggcgtc
attgccgccgccctggcagaggggctcgagctcgaaggcatcgccgcaagcctcgccggg
atcgcctcggtggaaggccgcatggaagtggtggacgccggccagccgttcctggtgctg
gtggattacgcccatacgccggacggcctggagaacgcgctgtccacggtctcgcagttt
gccgaaggaagcatctactgcgtgttcggctgcgggggagaccgggaccgcgcgaagcgt
ccgctgatgggcggcgtggcggccaagtacagcgactacatctacgtgacttcggataac
ccgcggacggagaatccggaggcgatcctgcaggacatcgttccagggatcgagcaggcg
ggcctggacccggcgagctacgagctcatcgcggaccggaaggaagcgatccgccgtgcg
gtggagagagcgcagccgggcgatatcgtgctcatcgccggcaaggggcacgagacgtat
caggacatcggcggggtcaaacatccgttcgatgaccggctggtggccaaggaagccgtc
atgggcaggacatga

DBGET integrated database retrieval system