KEGG   Paenibacillus mucilaginosus 3016: PM3016_5679Help
Entry
PM3016_5679       CDS       T01757                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pmq02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pmq02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6706889..6707488)
Genome map
AA seq 199 aa AA seqDB search
MEVEGGKGMRRYEAVVVGVSAGGLQALSVLLGCLPGDFPLPVLIVQHRLESSDSYLAESL
DRSLRIRVREAEDKLELEGGCVYLAPAGYHLLAEETRTASLSVDPRVNYSRPSVDVLFES
AAYVYGPRCIGVVLTGANGDGSAGLARIAAAGGLAVVQDPQEAEYDAMPRAAIAAVKADY
ILPLTGIGSLLSRLAQEEE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaggggggcaaaggcatgaggcgctatgaagcggtggtggtcggcgtgtcc
gcgggcgggctccaggcgctgtcggtcctgctcggctgtcttccgggggacttcccgctc
cccgtgctgatcgttcagcaccggctggagagcagcgacagctatctggccgaatcgctg
gaccgttccctgaggatccgggtcagggaagcggaggacaagctggagctcgaaggaggc
tgcgtgtacctggcccccgcgggctatcatctgctcgccgaggagacccgtacggccagc
ctgtcggtggacccgcgcgtcaattattcgcggccgtcggtcgatgtgctgttcgaaagc
gccgcgtatgtgtacgggccaaggtgcatcggcgtcgtactgaccggtgcgaacggggac
ggcagcgcgggtctggcccggattgccgccgccggcggactggcggtcgtgcaggacccg
caggaggcggaatatgacgcgatgccccgggctgcgatcgcggcggtgaaggcggattac
atcctgccgctgacggggatcggcagcctgctgagcaggctggcgcaggaagaggaatag

DBGET integrated database retrieval system