KEGG   Paenibacillus mucilaginosus 3016: PM3016_5834Help
Entry
PM3016_5834       CDS       T01757                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PM3016_5834
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_5834
   00052 Galactose metabolism
    PM3016_5834
   00500 Starch and sucrose metabolism
    PM3016_5834
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_5834
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PM3016_5834
   00524 Butirosin and neomycin biosynthesis
    PM3016_5834
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PM3016_5834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6897014..6897988)
Genome map
AA seq 324 aa AA seqDB search
MDKYIIGIDLGGTNIKSAVFTSEFEPILERSDSTDAGLGPAHVLGKIKIIIKTMLLESGI
DRHSVLCMGMGIPGLLDPREGISIFSPNFPHWENIHVVKEMQREFPFPVFIDNDVRLNLY
GEWLHGAGVGRRNIVLLTLGTGLGSGILADGRVLYGQTSSAGEIGHMNMVREGRPCRCGS
SGCLGRYVSATGMVRTFTEELDQGRESLIRSWVKNDSQQITAKMISDAYDLGDPLAIEVM
HETGRLLGFGLATFINLLNPELVIIGGGMSAAGDRLLGTVRDTIRKHALKLSSEACQVVQ
AALGGRSGMLGAAVYAARRVEGKW
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggataaatatatcatcgggatcgacttgggcgggacgaatatcaaatcggctgttttt
acttcggagttcgaaccgattctcgaacgaagtgattctacagacgccgggttgggaccg
gctcatgtgctgggtaaaatcaaaatcatcattaaaacgatgctgctggagtcggggatc
gatcggcactcggtgctgtgcatgggaatggggattccgggcctgctagatccgagagag
ggaatatccatcttttcaccgaatttcccgcattgggagaacatccatgtggtgaaggag
atgcagcgcgagttcccgtttccggtatttatcgataatgatgtccggctcaatctctac
ggggaatggctgcacggggctggggtcggccgcaggaacatcgtcctgctgacacttggg
acggggctgggttcgggcatcttggctgacggaagagtgctgtacggccaaacttcatca
gccggggagatcggccatatgaacatggtccgggagggccgtccgtgccgctgcggcagc
tcgggctgtcttggcaggtatgtctccgccacaggcatggtcaggacgttcacggaggag
cttgatcaaggcagggagagtcttatccgcagctgggtaaaaaacgattcccagcaaatc
actgcgaaaatgatttccgatgcgtacgatctgggagatccattggccatcgaggtgatg
catgagacgggcagactgcttggttttgggcttgcaaccttcatcaaccttttgaatccc
gaactcgtcattattggcggggggatgtcagctgcgggggatcgactgctcggtacggtc
cgcgataccattcggaagcatgcgttaaagctttcgtctgaagcgtgtcaggtggtccag
gctgcattgggcggcagatccgggatgctgggtgccgccgtttatgccgcaaggagggta
gagggcaagtggtaa

DBGET integrated database retrieval system