KEGG   Paenibacillus mucilaginosus 3016: PM3016_5960Help
Entry
PM3016_5960       CDS       T01757                                 

Definition
(GenBank) dihydrolipoyllysine-residue transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00020  Citrate cycle (TCA cycle)
pmq00620  Pyruvate metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
Module
pmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_5960
   00020 Citrate cycle (TCA cycle)
    PM3016_5960
   00620 Pyruvate metabolism
    PM3016_5960
Enzymes [BR:pmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PM3016_5960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 NQRA HlyD_D23 GCV_H Transferase HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFC32617
UniProt: H6NPK5
Position
complement(7058926..7060311)
Genome map
AA seq 461 aa AA seqDB search
MAKFEYRFPELGEGIHEGEIVKWHVKAGDKVNDETILMDVQNDKSTVEVPSPVEGTIVEI
KVGEGAVCTVGDVIAVIDVTGEMPEQAHGHGEAPSAAEAATPAAAKTEAEAAVGGIEPVG
SSVAANVANSKIDTPMAGGAPAAAAQPAVTPSGVLATPSVRKLAREKGVNLAQVTPTGKN
GRITREDVLGFTPGAAAAPAAAAPAASAAAPAAAAPAASAAAAVSGDRVEERVPLKGIRK
AIANAMVKSVYTAPHVTLMDEVDVTELVALRGRANKAMAEKKGMKLTYLPFIVKALVAAA
RQFPVMNAMIDEEKQEIVYKKYYNIGIATDTDNGLLVPVIQDADRKNIWTIAASIKDLAA
RGREGKLGPTELKGSTLTITNIGSAGGMFFTPVINFPEVAILGTGRITEKPVVKNGEIVV
APVMALSLSFDHRIIDGATAQNFMNYIKQLLADPELLIMEV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtttgagtaccggtttccggagctgggcgaaggcattcacgaaggcgagatt
gtcaagtggcatgtcaaagccggcgataaagtcaatgacgaaacgatcctgatggacgtt
caaaacgataaatccaccgtagaagttccttctcctgtagaaggcaccatcgtcgagatc
aaagtcggcgaaggcgcggtatgtacggttggcgacgtcatcgctgtaatcgacgtaacc
ggcgaaatgcctgagcaggcacacggccacggcgaagcgccaagcgcagcagaggcggct
acgccggctgcagcgaagacggaagctgaagcggctgtcggcggcatcgagccggtaggc
agctccgtagcggcgaacgtcgcgaacagcaagatcgacacgccgatggcaggcggcgct
ccggcagctgcagcccagcctgcggtaacgccgagcggcgtcctggctacgcctagcgtg
cgcaagctggcccgtgagaagggcgtaaaccttgcccaagtgacgccgaccggcaagaac
ggccgcatcacccgcgaggacgtgcttggcttcacgcctggcgcagcagcagctccagca
gcagcggctcctgcggcaagcgcagcggctccggcagcagcagcgccggcagcttccgca
gcggcagccgtaagcggcgatcgcgtcgaagagcgcgtaccgctgaagggcatccgcaag
gcgatcgcgaacgctatggtgaagagcgtgtacacggctcctcacgttacgctgatggac
gaagtcgacgttacggagctcgtcgctctgcgcggccgtgccaacaaagcgatggctgag
aagaaaggcatgaagctgacgtacctgccgttcatcgtgaaggctctcgtggcagcggca
cgccagttccctgtcatgaacgccatgatcgacgaagagaagcaggagatcgtctacaag
aagtactacaacatcggtatcgctaccgatacggataacgggcttctcgtaccggtcatc
caggatgcggaccgcaagaacatctggacgatcgcagcaagcatcaaggacctggctgcc
cgcggtcgcgaaggcaagctcggaccgacggaactgaagggctccacgctgacgatcacc
aacatcggttcggcaggcggcatgttcttcacgccggtgatcaacttccctgaagtggcg
atcctcggaaccggccgcattacggagaagccggttgtgaagaacggcgagatcgttgtg
gctccggtcatggcgctgtcactgagcttcgaccaccggattatcgacggtgctacggca
cagaactttatgaactacattaagcagctcctcgcagatcctgagctgctgatcatggag
gtgtaa

DBGET integrated database retrieval system