KEGG   Paenibacillus mucilaginosus 3016: PM3016_602Help
Entry
PM3016_602        CDS       T01757                                 

Definition
MelA protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pmq00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pmq00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pmq00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712928..714433
Genome map
AA seq 501 aa AA seqDB search
MSFKIAFIGAGSVGFTRGLLRDLLSVPEFHEVEIAFMDTSERNLEMVRQLCQRDILENGL
QIQIQATTDRREALRDAKYVLCTIRVGGLEAFATDVDIPLRYGIDQCVGDTLCAGGIMYG
QRGIAEMLKICKDIREVAREDVLLLNYANPMAMLTWACNAYGGVRTVGLCHGVQNGHRQI
AEAFGLEKEEVDIICAGINHQTWYVQIRHNGEDLTGRLLEAFEAHPEFNRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPEEIGEWIDLGSWINGETGGYLRVCTEGRRWFETDFP
NWLKEPALEYTPEKRGEEHGSYIIEGLETGRVYRGHFNVVNRGVISNLPDDAVIEAPGYV
DRSGISMAHVGSLPLGPAAVCNASISVQRLAVEAAVHGDDQLLRQAMLLDPLVGAVCNPR
EVWQMTDELLVAQEAWLPQYGAAIAEAKARLAEGLKVPVRDYRGAARLHVKTVEEMEANR
EQASRNAGESDKGKERAAAAQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaaattgcttttatcggtgccggcagtgtcggatttactcgggggctgctg
cgtgatctgctgtccgtgccggagttccatgaggtggagatcgcttttatggatacgagt
gaacggaacctggagatggtccgccagctctgtcagcgggatattctggagaacgggctt
caaatccaaatccaggcgactacagaccgcagggaagcgctgagggatgccaagtatgtg
ctgtgcacgatccgggtcggcgggctggaggcgttcgcgacggatgtggacatcccgctg
aggtacgggatcgaccagtgcgtcggggacacgctctgtgcgggcggcattatgtacggt
cagcggggcattgccgagatgctgaagatctgcaaggacatccgggaggtggcgcgggag
gacgtgctgctgctcaactatgccaacccgatggccatgctgacctgggcctgcaatgcg
tacggcggcgtgcggaccgtcggtctgtgccatggcgtgcagaatggacaccggcagatt
gcggaggccttcgggctggagaaggaagaggtcgatatcatctgcgcgggcatcaaccac
caaacctggtatgtgcagatccgccataacggagaagatcttaccggccggctgctggag
gccttcgaggcgcatccggaattcaaccgaacggagaaggtgcgcatcgatatgctgagg
cgcttcggttattacagcacggaatcgaacggccacctcagcgagtacgtgccgtggtac
cgcaagcgtccggaggagatcggggagtggatcgacctcggctcctggatcaacggggag
accggcggttatcttcgcgtctgcacggaagggcggcgctggttcgagacggacttcccg
aactggctgaaagagcccgcactggaatatacgccggagaagcgcggggaggagcacggt
tcttatatcatcgagggcctcgagaccggccgggtctaccgggggcacttcaacgtagtc
aaccggggcgtaatctccaatctgccggacgatgccgtcatcgaagcgccgggctatgtc
gaccgcagcggcatctcgatggcgcatgtcggaagcttgccgctggggccggccgccgta
tgcaatgcaagcatctccgttcagcggcttgctgtggaagcggcggtccacggggatgat
cagctgctgcggcaggcgatgctgctggaccccctcgtgggggcggtctgcaacccgcgg
gaagtgtggcagatgaccgacgagctgctggtcgcccaggaggcgtggctgccgcagtac
ggcgcagcgatcgccgaggccaaagcgcggctcgccgagggactgaaggtgcccgtacgc
gactaccgcggagcggcccgcctccacgtgaagaccgtggaggagatggaagcgaaccgc
gagcaggccagccggaatgcgggagagtccgacaagggcaaggagcgggcggcagcggcg
cagtaa

DBGET integrated database retrieval system