KEGG   Paenibacillus mucilaginosus 3016: PM3016_6030Help
Entry
PM3016_6030       CDS       T01757                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pmq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7137768..7138415)
Genome map
AA seq 215 aa AA seqDB search
MIDFLRGPVVYRDTEYVVLDVNGVGYRIFCANPFGVAPSKDGRDGGEVTMFIHYHVREDA
HLLFGFTTREEQSLFRLLLDVSGIGPKVAIGVLAGGRPETIAGAIRQENLSFLTKLPGIG
KKTAQRMVLDLKDKLGAITGGLDEGLFAPSEPLSAVPEGQGAWGEAKAALMALGYTEAEA
DRAGSAIKGKLKGGETADAVTKLALQALFQESMMR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattttttgaggggaccggtggtctaccgcgacacggaatatgtcgttctggac
gtgaacggcgtgggataccgcatcttctgcgccaacccgttcggtgtggcgccgtccaag
gacggcagggacggcggtgaagtgacgatgttcatccattaccatgtgcgggaagatgcg
cacctgctcttcggcttcacgacacgtgaggagcagtcgctgttccgcctgctcctggac
gtctcgggaatcgggccgaaggtggcgatcggcgtgctggccggcggccggccggagacg
atcgcgggggcgatccggcaggagaacctcagctttctcacgaagctgccgggcatcggc
aagaagacggcgcagcgcatggtgctcgacctgaaggacaagctcggggcgattaccggc
gggctcgacgaagggctgttcgcaccgagcgagccgctgtcagccgtgccggagggccag
ggcgcctggggcgaagccaaggcggcgctgatggcgctcgggtatacggaggccgaagcg
gaccgtgccggcagcgccatcaagggcaagctcaagggcggcgagacggcggatgccgtc
acgaagctggcgctgcaggcgctgttccaggaatcgatgatgagataa

DBGET integrated database retrieval system