KEGG   Paenibacillus mucilaginosus 3016: PM3016_6079Help
Entry
PM3016_6079       CDS       T01757                                 

Definition
HemB protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7187647..7188642)
Genome map
AA seq 331 aa AA seqDB search
MAFPLIRNRRLRTSAAMRRLVRENDVTLNDLIYPIFVTHGENIKEEIPSMPGVYHFSLDR
LQEEITEVSALGLPAVLLFGVPHEKDAHGSSAYDPNGIVQQATRLIKTWDSELLVIADTC
LCQFTDHGHCGVVHYDEAKQRADVVNDASLELLARTAVSQAEAGADIIAPSNMMDGFVHA
IRQGLDEAGYEHVPILSYSVKYASSFYGPFRDAAHSTPQFGDRKTYQMDPANGREALREA
DADVAEGADMLMVKPALAYMDVIRMLRDRYDLPICAYNVSAEYSMVKAAAAQGWIDERSI
VLETMVGFKRAGADMIITYFAKDIARWIARS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccattgatccgaaaccgccgtctgcgcacctcggccgccatgcgccggctg
gtgcgggagaacgacgtcaccctaaatgatctgatctacccgatctttgttacgcacggg
gagaacatcaaggaagagattccatcgatgcccggcgtgtaccacttctcgctggaccgt
ctgcaggaagagatcacggaggtatccgctctcggactgccggctgttctgctcttcggc
gtaccgcacgagaaggatgcccacggcagctcggcctacgacccgaacggcatcgtgcag
caggcaacccgtctgatcaagacctgggattcggagctgctcgtgatcgccgatacctgc
ctgtgccaattcacggatcacggccactgcggcgtggtgcactacgacgaggcgaagcag
cgggccgatgtcgtcaatgacgcatcgctcgaactgctggcccgtaccgcggtctcccag
gctgaagcgggggccgatatcatcgcgccttcgaatatgatggacgggttcgttcatgcc
atccgccaggggctcgacgaagccggctatgagcatgtgccgattctgtcctactccgtc
aagtatgcttcctcgttctacggtccattccgggatgcggcccattcgacgcctcaattc
ggcgaccgcaagacctatcagatggatccggccaacggacgggaagcgctgcgcgaagcg
gatgcggatgtggcggaaggagcggatatgctcatggtcaagccggctctggcctacatg
gacgttatccgtatgctgcgcgaccgctatgatctgccgatctgcgcttacaatgtcagc
gcggagtactcgatggtgaaggccgccgccgcccagggctggattgacgaacgctccatc
gtgctcgaaacgatggtgggcttcaagcgtgccggcgccgacatgatcatcacgtatttc
gccaaagacattgcccgctggatcgcccgttcctga

DBGET integrated database retrieval system