KEGG   Paenibacillus mucilaginosus 3016: PM3016_6151Help
Entry
PM3016_6151       CDS       T01757                                 

Definition
protein SpsL
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PM3016_6151
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PM3016_6151
Enzymes [BR:pmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PM3016_6151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7267374..7267829)
Genome map
AA seq 151 aa AA seqDB search
MIRNVLTKTLIRHSDDRGFFMELLREDDEIFNGFGQASLSLSYPGVIKAFHYHAQQDDIW
YFPSGQAQVVLHDLRPDSPTYKQTDVYYMGELSPYLLFIPRGVAHGYRVLGHLPATIVYF
TNKAYDPADPDEFRLAYNDPDIGFNWQTRFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaaacgtgctgaccaagacgctgatccggcatagcgacgaccggggatttttc
atggagctgctgcgggaggacgacgaaatcttcaacggcttcgggcaggcttccttgtcc
ctgagctatccgggagtaatcaaagcgttccactaccacgcgcagcaggatgatatctgg
tacttcccgtcggggcaggctcaggtggtgctgcatgatctgcggccggattcgccgacc
tacaagcagacggacgtgtattacatgggagaactcagtccgtatctgctcttcatcccg
cggggcgtggcccacggctaccgggtgctggggcatctgccggcgacgatcgtctacttc
acgaacaaggcctatgatccggccgacccggatgaattccggctggcttacaacgacccg
gatatcggtttcaactggcagacccgattccgctga

DBGET integrated database retrieval system