KEGG   Paenibacillus mucilaginosus 3016: PM3016_6151Help
Entry
PM3016_6151       CDS       T01757                                 

Definition
(GenBank) SpsL
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00521  Streptomycin biosynthesis
pmq00523  Polyketide sugar unit biosynthesis
pmq01130  Biosynthesis of antibiotics
Module
pmq_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PM3016_6151
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PM3016_6151
Enzymes [BR:pmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PM3016_6151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFC32794
UniProt: H6NRQ8
Position
complement(7267374..7267829)
Genome map
AA seq 151 aa AA seqDB search
MIRNVLTKTLIRHSDDRGFFMELLREDDEIFNGFGQASLSLSYPGVIKAFHYHAQQDDIW
YFPSGQAQVVLHDLRPDSPTYKQTDVYYMGELSPYLLFIPRGVAHGYRVLGHLPATIVYF
TNKAYDPADPDEFRLAYNDPDIGFNWQTRFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaaacgtgctgaccaagacgctgatccggcatagcgacgaccggggatttttc
atggagctgctgcgggaggacgacgaaatcttcaacggcttcgggcaggcttccttgtcc
ctgagctatccgggagtaatcaaagcgttccactaccacgcgcagcaggatgatatctgg
tacttcccgtcggggcaggctcaggtggtgctgcatgatctgcggccggattcgccgacc
tacaagcagacggacgtgtattacatgggagaactcagtccgtatctgctcttcatcccg
cggggcgtggcccacggctaccgggtgctggggcatctgccggcgacgatcgtctacttc
acgaacaaggcctatgatccggccgacccggatgaattccggctggcttacaacgacccg
gatatcggtttcaactggcagacccgattccgctga

DBGET integrated database retrieval system