KEGG   Paenibacillus mucilaginosus 3016: PM3016_6185Help
Entry
PM3016_6185       CDS       T01757                                 

Definition
protein GlsA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PM3016_6185
   00330 Arginine and proline metabolism
    PM3016_6185
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PM3016_6185
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PM3016_6185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7304986..7305930
Genome map
AA seq 314 aa AA seqDB search
MNPKNDLNLIADKLPEWLEESRKYTVLGRPASYIPELAYAPAEALGVTVMGADGTEITAG
DCGLTFTMQSISKVFTLLLALMDHGEDGVFQKVGMEPTGDDFNSMLKLELVPPGIPFNPL
INAGAIAISSLIHGVSPSDKLSRILAFFREVSGDPDLTYNEAVYASESAHAHRNRSLAYF
LKDNHVLDGDVEEVLDLYFKHCSIEVTCRHLARMALVLALNGKDPVSGRELIPKRYVAIA
KTFMITCGMYNASGEFAIKVGMPAKSGVAGGILALVPGRFGVGVIGPALNHKGNSTAGVH
LLQTMSEAMDWSIF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaagaacgatctgaatctcattgccgacaaactgccggagtggctcgaagaa
agccgcaaatataccgtcctcggccggcccgcctcctatattcccgagctggcttatgca
cccgcggaggccctgggggtcaccgtgatgggagcggacggcaccgaaatcacggcgggg
gactgcggacttaccttcaccatgcagagtatctccaaagtgtttactctgctgctcgcc
ctcatggaccacggggaagacggcgtcttccagaaggtgggcatggagccgaccggcgac
gatttcaactcgatgctgaagctggagctggtgccgcccggcatcccgttcaacccgctg
atcaatgcgggggccatcgcgatctcttcgctgattcacggggtttccccgtcggacaag
ctcagccggattctggccttcttccgcgaggtatcgggcgatcccgatctcacttataat
gaagcggtatacgcttccgagtcggcccatgcgcaccgcaaccggtcgctggcctacttc
ctgaaggacaatcacgtgctggacggggacgtcgaggaggtgctcgacctctacttcaag
cactgctccatcgaggtcacctgccgtcacctggcccgcatggctctcgtgctcgccctg
aacggcaaggacccggtgagcggccgcgagctgatcccgaagcgttatgtcgccatcgcc
aagacgttcatgatcacgtgcggcatgtataacgcttcgggcgagttcgcaattaaggtc
ggcatgccggcgaagagcggtgtggccggaggcatcctcgccctcgtgcccggacgcttc
ggcgtcggcgtcatcggccctgcgctgaaccataaaggcaacagcaccgcaggcgtgcat
ctgctccagacgatgtccgaggcgatggactggagtatattctaa

DBGET integrated database retrieval system