KEGG   Paenibacillus mucilaginosus 3016: PM3016_6185Help
Entry
PM3016_6185       CDS       T01757                                 

Definition
(GenBank) GlsA
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00220  Arginine biosynthesis
pmq00250  Alanine, aspartate and glutamate metabolism
pmq00471  D-Glutamine and D-glutamate metabolism
pmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PM3016_6185
   00220 Arginine biosynthesis
    PM3016_6185
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PM3016_6185
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PM3016_6185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AFC32826
UniProt: H6NRU0
Position
7304986..7305930
Genome map
AA seq 314 aa AA seqDB search
MNPKNDLNLIADKLPEWLEESRKYTVLGRPASYIPELAYAPAEALGVTVMGADGTEITAG
DCGLTFTMQSISKVFTLLLALMDHGEDGVFQKVGMEPTGDDFNSMLKLELVPPGIPFNPL
INAGAIAISSLIHGVSPSDKLSRILAFFREVSGDPDLTYNEAVYASESAHAHRNRSLAYF
LKDNHVLDGDVEEVLDLYFKHCSIEVTCRHLARMALVLALNGKDPVSGRELIPKRYVAIA
KTFMITCGMYNASGEFAIKVGMPAKSGVAGGILALVPGRFGVGVIGPALNHKGNSTAGVH
LLQTMSEAMDWSIF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaagaacgatctgaatctcattgccgacaaactgccggagtggctcgaagaa
agccgcaaatataccgtcctcggccggcccgcctcctatattcccgagctggcttatgca
cccgcggaggccctgggggtcaccgtgatgggagcggacggcaccgaaatcacggcgggg
gactgcggacttaccttcaccatgcagagtatctccaaagtgtttactctgctgctcgcc
ctcatggaccacggggaagacggcgtcttccagaaggtgggcatggagccgaccggcgac
gatttcaactcgatgctgaagctggagctggtgccgcccggcatcccgttcaacccgctg
atcaatgcgggggccatcgcgatctcttcgctgattcacggggtttccccgtcggacaag
ctcagccggattctggccttcttccgcgaggtatcgggcgatcccgatctcacttataat
gaagcggtatacgcttccgagtcggcccatgcgcaccgcaaccggtcgctggcctacttc
ctgaaggacaatcacgtgctggacggggacgtcgaggaggtgctcgacctctacttcaag
cactgctccatcgaggtcacctgccgtcacctggcccgcatggctctcgtgctcgccctg
aacggcaaggacccggtgagcggccgcgagctgatcccgaagcgttatgtcgccatcgcc
aagacgttcatgatcacgtgcggcatgtataacgcttcgggcgagttcgcaattaaggtc
ggcatgccggcgaagagcggtgtggccggaggcatcctcgccctcgtgcccggacgcttc
ggcgtcggcgtcatcggccctgcgctgaaccataaaggcaacagcaccgcaggcgtgcat
ctgctccagacgatgtccgaggcgatggactggagtatattctaa

DBGET integrated database retrieval system