KEGG   Paenibacillus mucilaginosus 3016: PM3016_6363Help
Entry
PM3016_6363       CDS       T01757                                 

Definition
(GenBank) GtaB4
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00040  Pentose and glucuronate interconversions
pmq00052  Galactose metabolism
pmq00500  Starch and sucrose metabolism
pmq00520  Amino sugar and nucleotide sugar metabolism
pmq01100  Metabolic pathways
pmq01130  Biosynthesis of antibiotics
Module
pmq_M00362  Nucleotide sugar biosynthesis, prokaryotes
pmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PM3016_6363
   00052 Galactose metabolism
    PM3016_6363
   00500 Starch and sucrose metabolism
    PM3016_6363
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_6363
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PM3016_6363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AFC32995
UniProt: H6NE42
Position
complement(7516495..7517385)
Genome map
AA seq 296 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIIDKPTIQYIVEEAVESGIEDIIIVTGKG
KRAIEDHFDHVHELEHNLNEKGKLELLEEVRRSSKVELHFIRQKEPKGLGHAVWTARKFI
GNEPFAVLLGDDIVSAEKPCLRQLIEQYEQTGSSVIGVQKVSDEETNRYGIIDPGQNQDR
LYEVRKFVEKPALGTAPSNLAIMGRYILTPEIFDILSLQELGAGGEIQLTDAIQKLNELQ
RVYAYNFEGTRHDVGEKLGFILTTLQFAMKSKELRQPVLNAIKETLANHKLIDVIG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcaattattcccgcagcaggacttggaacaaggtttttgccc
gctacgaaggcgatgcccaaagagatgcttcccatcatagacaagcctaccatccagtat
attgtggaagaagccgtagagtccggaattgaagatatcattatcgtgacaggcaaaggc
aaacgggccattgaggatcatttcgaccatgttcacgagcttgagcataatctgaacgaa
aaaggcaagctggagcttctcgaggaagtacgccgttcttcgaaggtggagctgcacttc
atccgtcagaaagaaccgaagggtcttggacatgccgtatggaccgcacgcaagttcatc
gggaacgagccgttcgccgtacttctcggagacgatatcgtctcggccgagaagccttgc
ctgagacagctgatcgaacaatatgagcaaaccggctcctcggtgatcggtgtacagaaa
gtatccgatgaggagaccaaccgttacggcatcatcgatccgggtcagaaccaggatcgt
ctctacgaagtgcgtaaattcgtggaaaagccggctctgggcacagcgccttccaacctc
gcgatcatgggccgctacatcctgacgccggaaattttcgacattctgtccctgcaggag
ctgggtgccggtggagagattcagctgaccgatgctatccagaagctcaacgagctgcag
cgggtgtacgcctacaatttcgaaggcacacgccatgatgtgggcgagaagctgggcttt
atcctgacgacgctgcaattcgcgatgaagtcgaaggagcttcgccagccggtcttgaac
gcgatcaaggaaaccttggccaaccacaagctgattgatgtgattggctaa

DBGET integrated database retrieval system