KEGG   Paenibacillus mucilaginosus 3016: PM3016_6408Help
Entry
PM3016_6408       CDS       T01757                                 

Definition
cobyric acid synthase
Organism
pmq  Paenibacillus mucilaginosus 3016
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7563816..7566587)
Genome map
AA seq 923 aa AA seqDB search
MLEKYGHGGDLQTAAEKYGRPPGEFVDYSSNMNPFGPPEAAGHILRTRWQEAAAYPDPAA
RELTRRLAEKHGVDPACILVGNGAAELIDLAVRVLRPAVTGLARPSFKEYEDAVRKTGGA
VKDIPLREEQGFELQLQDLEAAAPHCDLLFLGSPNNPTGRLLPQAVRERLASDALPAVVD
EAFLDFLPEEEKLSLAAAASSSPNLIVLRSMTKFYAIPGLRLGYAVAHPDRIWAMRELQV
PWSVNAFAQWIGAAVLEDRAYARRTLEWLPGARAELLAGLRELGVLAWDSDTNYVLCSLR
ALGWTGRGLQEAMGRRGILIRDASLFPGLDDSYVRLAVKLPQMNRRLLAVLAEVFAERQR
EGRGRAAAEAAAAGAAQTAPYAVEGLGAEAPASSGPDAPLSPAGAGPSRRRGSVVMLQGT
ASDVGKSLLTAALCRILLQDGRRVAPFKSQNMSLNSYVTPDGKEIGRAQGMQADACRIPA
TTDMNPILLKPKKDMVAQVVVHGRPYQDLDARTYRERYLPEAEGVVKEALERLRSVHDVV
VIEGAGSPAEVNLKDRDIVNMRLAGWADAPVLLVADIDRGGVFASLVGTLEILTPEERAR
VRGFVINKFRGDVTLLQPGIDWLEARTGIPVLGVIPYLPQLGLEDEDSASLERKLAETAR
SGPPAKLPPEMLDIAVLRLPRISNFTDADPLAFEPDVRLRFVSSPEDFGQPDAVIIPGSK
NTVDDLLYLRSSGLDRRLLAYAAGGGFVTGICAGYQMLGARLLDPQLVESDKPELEGLGL
LPTETLFAAEKRTVQAAGVARLYGGYPVEGYEIHMGRTTFLEPVEHPFLLQEEGSAGLPD
GAAVAEGRVWGTYLHGVLHSDDFRRAWLNRIRESRGLAPLPAELRFTERREAAFDRLAGH
VRSHLDMERLYEMIQEQETAILT
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgttggagaaatacgggcacggcggggacctacagacggcggcggagaagtacggcagg
ccgccgggggagtttgtcgattacagctcgaatatgaatccgttcggtccgccggaggcg
gcagggcacatactgcgcacacgctggcaggaagcggccgcttatccggacccggcggcc
agggagctgacgcgacggctggcggagaagcacggcgtggacccggcgtgcattctcgtc
ggcaacggggccgccgagctgatcgatctggctgtgcgggtgctgcgccctgcggttacg
ggactggcccgcccctcgttcaaggaatacgaggatgcggtgcggaagacgggcggggcc
gtcaaggatatccccctgagggaggagcagggcttcgagctgcagctgcaggatctggag
gcggcagcgccccactgcgacctgctgttcctcggctcgccgaacaatccgacagggcgg
ctgctgccgcaggccgtgcgtgagaggcttgcctcggacgcgcttccggcggtcgtcgac
gaggcgttcctcgactttctgccggaggaagagaagctgtcgcttgccgccgcagcctcg
tcgagcccgaatctcatcgtgcttcgctcgatgacgaagttctacgcgatcccgggtctg
cggctcggctatgccgtcgcgcatccggaccgcatctgggccatgagggagctgcaggtg
ccgtggagcgtcaatgcgttcgcccagtggatcggggcggcggtgctggaggaccgcgct
tacgcccggcggacgctggagtggctgcccggggcgagggctgagctgctcgcgggcctg
cgggagctgggtgtgctggcctgggacagcgacacgaattatgtgttgtgctcgctgcgg
gcgctcgggtggaccgggcgtgggttgcaggaagccatggggcgcaggggcatcctcatt
cgcgacgcctcgctgttcccgggcctggacgattcctacgtccggctcgcggtgaagctc
ccgcagatgaaccggcggctgctcgccgtgctggcggaggtcttcgcggagcggcagcgg
gaaggtaggggccgtgcagctgctgaggcggcggcagcgggcgcagctcagacggcgcct
tacgcagtagagggcttgggcgcggaagcaccggcttcttccggcccggacgccccgctc
tcaccggcgggagcaggaccgtcccgccgccgaggatcggttgtcatgctgcagggcacg
gcttcggacgtcggcaagagcctgctgaccgctgcgctctgccgcattctgctgcaggac
ggccgccgggtggcgccgttcaagtcgcagaacatgtccctgaactcctacgtgacgccg
gacggcaaggagatcggccgggcccagggaatgcaggccgatgcctgccgcattccggcg
acgacggacatgaacccgatcctgctcaagccgaagaaggatatggtggcgcaggtcgtc
gtccacggcaggccgtatcaggatctcgacgcccgcacctaccgggaacgctacctgccc
gaggcggagggcgtggtcaaggaagcgcttgagcggctgcgcagcgttcacgacgtggtc
gtgatcgagggagccggcagcccggccgaggtgaacctgaaggaccgcgatatcgtgaac
atgcggctggcgggctgggcggacgcaccggtgctgctcgtcgcggatatcgaccggggc
ggcgtgttcgcttcactcgtcggcacgctcgaaatcctgacgcctgaagaacgtgcccgt
gtccgcggctttgtcattaacaagttccgcggagacgtgacgctgctgcagccggggatc
gactggctggaggcgcgcacgggcatcccggtgctcggggtgatcccgtacctgccgcag
ctcggtctcgaggacgaggattcggcctcgctcgagcgcaagctggccgagacggcgcgc
agcggccctccggcgaagctgccgcccgagatgctcgacatcgcggttctgcgcctgccc
cgcatctccaacttcacggatgcggatccgctggccttcgagccggatgtgcgcctgcgg
ttcgtctcctcgcccgaggacttcgggcagccggatgccgtgatcattcccggcagcaag
aatacggtcgacgacctgctctatcttcgttcgagcgggctggaccgcaggctgctcgcg
tatgcggcaggcggcggctttgtcaccggcatctgtgccggctatcagatgctcggggcg
cggctgctcgatccccagcttgtcgaatccgacaagccggagcttgagggcctcggcctg
ctgccgaccgaaacgctgtttgccgccgagaagcggaccgtccaggcggcgggagtcgcg
aggctgtacggcggctacccggtcgaaggctacgagatccacatgggccgtacgaccttc
ctggagccggtggagcatccgttcctgctgcaggaggaaggctccgcaggtctgccggat
ggagctgcggtggccgaaggacgcgtctggggcacgtaccttcacggcgtgctgcacagc
gacgacttccggcgcgcctggctgaaccgtatccgggagagcagggggcttgccccgctg
ccggccgagctgcggttcaccgaacggcgggaggccgccttcgaccggctggccgggcat
gtgcgctcccacttggatatggagcgtttgtatgagatgatacaggaacaggaaactgcc
attcttacctaa

DBGET integrated database retrieval system