KEGG   Paenibacillus mucilaginosus 3016: PM3016_6492Help
Entry
PM3016_6492       CDS       T01757                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PM3016_6492
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PM3016_6492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7655015..7655839)
Genome map
AA seq 274 aa AA seqDB search
MRRLEGKRIALTGPRKAAELSIMVEKLGGIPVVRPAQGSVEMQREKVEEEIRKLVREGTD
WIVLTTSQGTEMLLEVAESIGLREEFLETLRQTPLAVRGYKTVKYLKTLDIEPEVKADDG
TTVGILRALQERSLDLQGRKVALQLYGDHAPRLVEWLASQGALHYGILPYRHVPPDLTVV
DTLLGEILGGAIDAVTFTSTPQVRFLMAYAREQGLAEKVLEAFRERVVGVAVGKVTAEAL
RDEGIVRVVAPEEERMGSMIVSLAKYYEDSEKTG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagattggaaggcaaacgcatcgcattgacggggccgcggaaggcggcggagctc
agtattatggtcgagaaactcggagggattcccgtggtccgtccggcccagggttcggtg
gagatgcagcgcgagaaggtggaggaagagatccgcaagctggtccgggagggcacggac
tggatcgtgctgacgacatcccaggggacggagatgctgctggaggtggcggaaagcatc
ggtctgcgggaagagttcctggagacgctccggcaaactccgctcgccgtacggggctac
aagacggtgaaatacctcaaaaccctggatatcgagccggaagtgaaagcggacgatggg
acgacggtcggtattctccgggcgcttcaggagcgttcgctggacctgcagggccgcaaa
gtggccctgcagctgtacggggaccatgcgccgcggctggtggaatggctggcttcgcag
ggggccctacattacgggattctgccttaccggcatgtgccgccggacctgacggtcgtc
gatacgctgctcggcgagattctgggaggggcgatcgatgcggtgacgttcacctccacc
ccgcaggtacgcttcctgatggcctatgcacgggagcaggggcttgcggagaaggtgctg
gaagccttccgcgagagagtcgtgggtgtcgctgtgggcaaggtaacggccgaagcgctg
cgtgacgaaggcattgtgcgcgtggtggcgccggaggaagagcggatgggcagcatgatc
gtctcgctggccaagtactatgaggactccgagaaaaccggataa

DBGET integrated database retrieval system