KEGG   Paenibacillus mucilaginosus 3016: PM3016_6667Help
Entry
PM3016_6667       CDS       T01757                                 

Definition
XylA protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pmq00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmq00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7856750..7858063)
Genome map
AA seq 437 aa AA seqDB search
MSIFKNVPKIAYEGRNSDNPFAFKHYNPQEVVLGKTMEEHLRFAVAYWHTYTANGTDPFG
VGTMVRAWDSYSGLDQAKKRVEANFEFLDKIGVPYFCFHDRDIAPEGETLQETNKNLDVI
VAMTKEYMQSSGKKLLWNTANMFSNPRFVHGAGTTNNADVFAYAAAQVKKGLEVGLELGA
ENYVFWGGREGYETLLNTNMKLELDNLARLLHMAVDYAKEIGFGAQFLIEPKPKEPTKHQ
YDFDAATTIAFLQNYGLKEHFKLNLEANHATLAGHTFEHELHVARINGMLGSLDANQGDM
LLGWDTDEFPTDLYSATLTLYEVLKNGGLGKGGVNFDAKVRRGSFEDEDLFYAHIAGMDS
YARGLKAAAKLIEERILDDIIDNRYRSFNEGIGAEIVSGKATLASLEQYALQNNPIRNES
GRLERIRATLNEVIFSV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattttcaagaacgtaccgaagattgcctatgaaggccgcaattccgataacccg
tttgcattcaagcactacaacccgcaggaagtggtgctcggcaaaacgatggaagagcat
ctgcgctttgcagtcgcttactggcatacttataccgcgaacggcaccgacccgttcggt
gtgggcacaatggtccgcgcctgggacagctacagcggtctcgatcaggcgaagaagcgc
gtagaagcgaacttcgagttcctggataagatcggcgttccgtacttctgcttccatgac
cgcgacatcgctccggaaggcgagacgctgcaggagacgaacaagaacctcgacgtcatc
gtggcgatgaccaaggaatacatgcagtccagcggcaaaaaactgctctggaacaccgcg
aacatgttctcgaacccgcggtttgtccacggtgcaggcacgacgaacaatgcggacgtg
ttcgcatatgcggcagcccaagtgaagaagggcctcgaagtggggctcgagctcggcgcg
gagaactatgtgttctggggcggccgggaaggctacgagacgctgcttaacacgaatatg
aagcttgagctggataacctggcgcgcctgcttcatatggctgtagactacgcgaaggaa
atcggcttcggcgcccagttcctcatcgagccgaaaccgaaggagccgacgaagcaccag
tacgacttcgatgcggcaacgacgatcgcgttcctgcagaactacggcctgaaggagcac
tttaagctgaacctcgaagccaaccatgccacgctggccggccacacgttcgagcacgag
ctgcatgtggcgcgcatcaacggcatgctcggttccctcgacgcgaaccagggcgacatg
ctgctcggctgggataccgacgagttcccgaccgacctgtactcggctactctgacgctg
tatgaagtgctgaagaacggcggcctcggcaagggcggcgtgaacttcgacgccaaagta
cgccgcggctctttcgaagacgaggatctgttctacgcgcacatcgccggcatggactcc
tatgcccgcggcctgaaggctgcagcgaagctgatcgaagagcgcattctcgacgacatc
atcgacaaccgctaccgcagcttcaacgaagggatcggtgccgagatcgtatccggcaaa
gcaacgctggcttccctcgagcagtacgcgctgcagaacaatccgatccgcaacgagtcc
ggccgcctggagcgcatccgcgctacgctgaacgaagtgatcttcagcgtataa

DBGET integrated database retrieval system