KEGG   Paenibacillus mucilaginosus 3016: PM3016_6750Help
Entry
PM3016_6750       CDS       T01757                                 

Definition
cytochrome o ubiquinol oxidase subunit IV
Orthology
K02300  
cytochrome o ubiquinol oxidase operon protein cyoD
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pmq00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7952186..7952518)
Genome map
AA seq 110 aa AA seqDB search
MAQQHHGDSASHDASHGSLKSYVIGFLLSIVLTIIPVAAVMNHMLEGKPLLILILAMAIL
QFAVQLVFFMHLKEGENARWNIMALILGMIILLTIVAGSIWIMTYNQVAH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcagcatcacggcgattccgcttctcatgatgcgtcccacggttccctaaag
tcgtatgtgattggcttcctgctctcgatcgtactgacgatcattccggttgccgcggtc
atgaaccacatgctggagggcaagccgctgctgatcctcatcctcgcgatggcgatcctt
cagttcgcagtgcagctggtgttcttcatgcacctcaaggaaggcgagaatgcgcgctgg
aacatcatggcgctgatcctcgggatgatcatcctgctgacgatcgtcgccggatcgatc
tggatcatgacgtacaatcaggtagcccattaa

DBGET integrated database retrieval system