KEGG   Paenibacillus mucilaginosus 3016: PM3016_7005Help
Entry
PM3016_7005       CDS       T01757                                 

Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00330  Arginine and proline metabolism
pmq01100  Metabolic pathways
Module
pmq_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PM3016_7005
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PM3016_7005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AFC33596
UniProt: H6NRG1
Position
complement(8228099..8229061)
Genome map
AA seq 320 aa AA seqDB search
MQYPLSPDVQPEFCTTGSFMRLPAKREGARLAIVGMPFDTAASFRVGARFAPQAIRQGSM
LLFPYHPVHKVYPFEETKAIDIGDVSVIPHNIHRSYELMEASALELMQAGIVPVGLGGDH
SVTLAALRAAAKVHGPVALVHFDSHTDTWDTYYDEKYWHGSTFIRAHEEGLVVPSKVFQI
GIRGTLNHPGDLEASYDLGFNVITSGELRAAGIPEVVRRVKETVGDMPVFLTFDIDFVDP
AYAPGTGTPEVGGFTSHETLELVRSLTGLNYIGFDLVEVLPGYDPAQTTSLLAATLIHEF
ASLVALNLKTASPQESITGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccgttatctcccgatgttcagcccgagttctgtacgaccggctcgttcatg
cggcttccggcgaagcgggaaggcgcaaggcttgcgatcgtcggcatgccgttcgatacg
gccgcctcgttccgggtgggggcgcgcttcgcgccgcaggcgatccgccagggatcgatg
ctcctgttcccctaccacccggtgcataaggtatacccgttcgaggagacgaaggccatc
gacatcggggatgtctcggtcatcccgcacaacatccaccgcagctatgagctgatggaa
gccagcgcgctggagctgatgcaggccgggatcgtaccggtcggccttgggggggaccac
tccgtgacgctggctgcgctgcgtgcggcggccaaggtgcacgggccggtggcgctggtg
cattttgactcccacacggatacgtgggacacctactacgatgagaagtactggcacggc
tccaccttcatccgtgcgcatgaggaaggactcgtcgtcccttccaaggtgttccagatc
gggatccggggaacgctgaaccatcccggcgatctggaggcgagctacgatctcgggttc
aacgtgatcacctcgggagaactccgagcggcgggcattccggaggtcgtgcgccgcgtc
aaggaaacggtcggcgatatgccggtgttcctgaccttcgacatcgacttcgtcgatccg
gcctatgcgccggggacggggacgccggaggtcggcggattcacaagccatgagacgctc
gagctcgtccggtcgctgaccggtttgaactatatcgggttcgacctggtcgaagtgctg
ccgggctatgatccggcccagacgacttcgctgctggctgcgacgctgatccacgagttc
gcgagtctggtcgccctgaaccttaagacggcgagcccgcaggagagcatcacgggggcc
taa

DBGET integrated database retrieval system