KEGG   Paenibacillus mucilaginosus 3016: PM3016_7005Help
Entry
PM3016_7005       CDS       T01757                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8228099..8229061)
Genome map
AA seq 320 aa AA seqDB search
MQYPLSPDVQPEFCTTGSFMRLPAKREGARLAIVGMPFDTAASFRVGARFAPQAIRQGSM
LLFPYHPVHKVYPFEETKAIDIGDVSVIPHNIHRSYELMEASALELMQAGIVPVGLGGDH
SVTLAALRAAAKVHGPVALVHFDSHTDTWDTYYDEKYWHGSTFIRAHEEGLVVPSKVFQI
GIRGTLNHPGDLEASYDLGFNVITSGELRAAGIPEVVRRVKETVGDMPVFLTFDIDFVDP
AYAPGTGTPEVGGFTSHETLELVRSLTGLNYIGFDLVEVLPGYDPAQTTSLLAATLIHEF
ASLVALNLKTASPQESITGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatccgttatctcccgatgttcagcccgagttctgtacgaccggctcgttcatg
cggcttccggcgaagcgggaaggcgcaaggcttgcgatcgtcggcatgccgttcgatacg
gccgcctcgttccgggtgggggcgcgcttcgcgccgcaggcgatccgccagggatcgatg
ctcctgttcccctaccacccggtgcataaggtatacccgttcgaggagacgaaggccatc
gacatcggggatgtctcggtcatcccgcacaacatccaccgcagctatgagctgatggaa
gccagcgcgctggagctgatgcaggccgggatcgtaccggtcggccttgggggggaccac
tccgtgacgctggctgcgctgcgtgcggcggccaaggtgcacgggccggtggcgctggtg
cattttgactcccacacggatacgtgggacacctactacgatgagaagtactggcacggc
tccaccttcatccgtgcgcatgaggaaggactcgtcgtcccttccaaggtgttccagatc
gggatccggggaacgctgaaccatcccggcgatctggaggcgagctacgatctcgggttc
aacgtgatcacctcgggagaactccgagcggcgggcattccggaggtcgtgcgccgcgtc
aaggaaacggtcggcgatatgccggtgttcctgaccttcgacatcgacttcgtcgatccg
gcctatgcgccggggacggggacgccggaggtcggcggattcacaagccatgagacgctc
gagctcgtccggtcgctgaccggtttgaactatatcgggttcgacctggtcgaagtgctg
ccgggctatgatccggcccagacgacttcgctgctggctgcgacgctgatccacgagttc
gcgagtctggtcgccctgaaccttaagacggcgagcccgcaggagagcatcacgggggcc
taa

DBGET integrated database retrieval system