KEGG   Paenibacillus mucilaginosus 3016: PM3016_7108Help
Entry
PM3016_7108       CDS       T01757                                 

Definition
protein FolK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PM3016_7108
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PM3016_7108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8332405..8332935)
Genome map
AA seq 176 aa AA seqDB search
MNEEKADIHSQEDLAVAYIGLGSNLGDREQYLKEALRMLEEHPEIRILGLSSFYETDPVG
YVDQDPFLNMVAAVGTTLSPEDLFAQMLGAEQHLGRKREVRWGPRTIDLDLLLYGSRTQE
DPRLILPHPRMMERAFVLIPLIEVMKAQNPQQAGALEDHLRRLSGKEGVTLWKRMQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagagaaggcggatatacattcgcaggaagatctggcggtggcttatatcggc
ctcggctccaacctgggcgaccgggagcagtacctgaaggaggcgctccgcatgctggaa
gagcatccggagatccgcatcctcggcttgtcctccttctatgagacggatccggtcggc
tatgtcgatcaggacccgttcctgaacatggtggcggcagtcggaacgacgctgtcgccg
gaggatttgtttgcgcagatgctgggtgccgagcagcacctggggcgcaagcgggaggtg
cgatgggggccaagaaccatcgatctcgatctgttgctctacggaagccgcactcaagag
gatccccgtctgattctgccgcatccccgcatgatggaacgtgccttcgtgctcattccg
ctcatcgaggtgatgaaggctcagaatccgcagcaggcaggggccctcgaagatcatctt
cggcggctttcaggaaaggaaggcgttacgttatggaaaagaatgcagtag

DBGET integrated database retrieval system