KEGG   Paenibacillus mucilaginosus 3016: PM3016_7147Help
Entry
PM3016_7147       CDS       T01757                                 

Definition
protein IspE
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PM3016_7147
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PM3016_7147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8372431..8373198)
Genome map
AA seq 255 aa AA seqDB search
MVMTMVDLADRIEMQELPRDTIIISSQAGYIPLDEKNLAFQAARLIKDRYDVKQGVYIHL
DKKIPVAAGLAGGSSDAAATLRGLNRLWKLGIPSEELQRLGAELGSDVPFCVTGGTAVAR
GRGEKLEHIEAPPQCWVVLAKPPINVSTSEIYGKLNAAGIRKHPSTAAVLEAIRTKRFDA
LCGSLGNVLEEVTLDLYPEVRQLKEVMIRLGADGVLMSGSGPTVFGLVSKESKVARIYNG
LRGFCKDVYAVRLLT
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgaccatggtcgatctggccgaccggatcgagatgcaggagctgccgcgcgat
acgatcatcatctcctcgcaggcagggtatattcccttggatgagaagaatctggccttt
caggcggcccgcctgatcaaggaccgttatgatgtaaagcagggcgtatatattcatctc
gacaaaaaaattcccgtagcggcgggtctggcgggaggcagcagcgatgcggcggccacg
ctccgcggtctcaaccggctgtggaagcttggcatcccctcggaggagctgcagcggctc
ggagcggagctcggctcggacgtgccgttctgcgtgacgggcggaaccgcggtggcccgc
gggcggggagagaagctcgagcatatcgaggctccaccccaatgctgggtggtcctggcc
aagccgccgatcaatgtatcgacttcggagatctatggcaagctcaacgccgccggcatc
cggaagcatccctcgacggcggcggtgctggaggcgatccggacgaagcgcttcgatgcg
ctctgcggcagccttggcaacgtgctggaggaagtgacgctggatctgtatccggaggtc
aggcagctcaaggaagtcatgatccggctgggagctgacggcgtactcatgtcagggagc
gggcctacggtattcgggctggtctccaaagagtccaaggtcgcccggatctacaacggg
ctgcggggcttctgcaaagacgtctacgctgtccgcctgttaacgtaa

DBGET integrated database retrieval system