KEGG   Paenibacillus mucilaginosus 3016: PM3016_7190Help
Entry
PM3016_7190       CDS       T01757                                 

Definition
protein SpeB
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PM3016_7190
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PM3016_7190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8415689..8416558)
Genome map
AA seq 289 aa AA seqDB search
MRLDQKYSGNVFILSSDDYAASRAVIYGMPMDYTVSFRPGSRFGPTRVREVSIGLEEYSP
YLDKSLEDITYFDAGDLLLPFGNAGRSLEIIGEYVKGLLDDNKFPFGLGGEHLVSWPVIQ
QMYAKYPDLAIIHFDAHADLRESYEGEPLSHSTPLRKAAGLMGGKNIYQFGIRSGSREEF
TYARENINFHPFEVLEPLKKRLPELAGRPVYLTIDIDVLDPSCAPGTGTAEPGGITSKEL
LDAIHAMAASDVNFVGADIVEVAPHYDHSEQTQIVASKVMREILLGLVK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgaccaaaaatattccggcaatgtgttcatcctgagctcggacgactatgcg
gcctcccgcgcggtcatctacggcatgccgatggactacacggtatcgttccgtcccggc
tcccgcttcggccctacgcgcgtgcgcgaagtgtcgatcggcctggaagaatacagccct
tatctcgataaaagcctggaagacatcacttacttcgatgccggcgatctgctgctgcca
ttcggcaacgcggggcgttcgctcgagatcatcggggagtatgtgaagggcctgctggac
gacaacaaattcccgttcggcctcggcggggagcacctggtctcctggccggtcattcag
cagatgtacgcgaagtatccggacctggcgatcattcactttgacgcccacgcggatctg
cgcgaatcgtacgagggcgagccgctctcgcactcgacgccgctgcgcaaggccgccggc
ctcatgggcggcaagaacatttatcagttcggaatccgttccggctcccgtgaagaattc
acgtatgcgcgcgagaacatcaacttccatccgttcgaagtgctcgagccgctgaagaag
cgtctgccggaactcgcgggccgtccggtctatctcacgatcgacatcgacgtcctcgac
ccgtcctgcgcaccgggcaccggtaccgccgagccgggaggcatcacctcgaaggagctc
ctggatgccatccatgcgatggcggccagcgacgtcaacttcgtgggcgccgacatcgtc
gaagtggcgccgcattacgaccactcggagcagacgcagatcgtcgcatccaaggtgatg
cgcgagattctgctcggcctcgtgaaataa

DBGET integrated database retrieval system