KEGG   Paenibacillus mucilaginosus 3016: PM3016_732Help
Entry
PM3016_732        CDS       T01757                                 

Definition
PhoD protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PM3016_732
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PM3016_732
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PM3016_732
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PM3016_732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854217..855854
Genome map
AA seq 545 aa AA seqDB search
MEQDKLGLLQQMMEKLGASSMDRRGFLRATGKVAAVSFGLTLASALQSPPKIGAEAFFKS
YPFTLGIASGDPLPDGVVLWTRLAPDPLNGGGMPSHDVPVRWEVALDKEFRRIVKHGVEF
ARTALAHSVHVEVEGLEPNQVYYYRFHAGNVESPVGRTKTLPPYGSAVAGMTFAFASCQN
WQDGYYTAYKHMSKENLDLVFHLGDYIYEGGVGTDKVRYHNSPEIVTLEDYRNRYALYKS
DADLRAAHEAFPWVVTTDDHEVENNYAGPIPEKDQPVEPFVQRRAAAYQAYYEHMPLRRS
SLPYGTEMQLYRRVTYGNLAEFSVLDTRQYRDDQANGDGSKEPNEASMDPNRTLMGAAQE
RWLLEGLGASAARWNVIPQQVFFAKRDFKQGDAELVSMDAWDGYSANRDRIVNFIKERGV
RNVVVLTGDVHANYANEIKADYHDPASPVIGVEFVGTSISSGGDGADTAANTATILAENP
HIRFHNTQRGYVRCTLTPDRFQADYLVLPYVSRPDAPIETRVSFEVEDGRPGLKKIYDSA
LVVTG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggacaagcttggcctgctgcagcagatgatggagaagctcggggcttcctcc
atggaccggagggggttcctccgcgcaaccggcaaggtggcagcggtttcattcggactt
acgctggcgagtgcgctgcagtcaccgccgaagatcggtgcggaggcgttcttcaagagc
tatccttttaccctcgggattgcttcgggtgacccgcttccggacggcgtagtcttgtgg
acccggctcgcaccggaccctctgaacggcgggggcatgccgtctcatgacgtgcccgta
cgctgggaagtggcgctcgacaaggagttccgccgcatagtcaagcatggcgtggagttc
gcgcggacggcacttgcgcattcggtacacgtggaagtggaagggctggagccgaatcag
gtgtactactaccggttccatgcagggaatgtggagagtccggtgggcaggaccaagacg
ctcccgccttacggcagcgcggtagcgggaatgacctttgcttttgcctcctgtcagaac
tggcaggacggatattacaccgcttacaagcatatgagcaaagagaacctcgatcttgtg
ttccacctcggcgattatatctacgaaggcggcgtcggcacggacaaggtccgctatcac
aacagtccggagattgtgacgctggaggattaccggaaccggtacgccctgtacaagtcg
gatgcggacctgcgggccgctcacgaggcgttcccttgggtcgtcactacggatgatcat
gaagtggaaaataactacgcggggccgatcccggagaaggaccagccggtcgagccgttc
gtacagcgccgggcggcggcctaccaggcttattacgagcacatgccgcttcgccgctcc
tcgctgccgtacgggaccgagatgcagctgtaccgccgggtgacttacggcaatctggcg
gaattcagcgtgctggatacccgccaataccgcgacgaccaggcgaacggcgacggctcg
aaggagccgaacgaggcgtcgatggatccgaaccggaccctgatgggtgccgcgcaggag
cgctggctgctggaggggctcggtgcctccgccgcacgctggaacgtgattccgcagcag
gtgtttttcgccaaacgggacttcaagcagggggatgcggagcttgtcagcatggatgcc
tgggacggctactcggcgaaccgggaccggatcgtgaacttcatcaaggaacgcggggtc
cgcaacgtggtggtgcttaccggcgacgtccacgcgaattatgccaatgagatcaaggcg
gattaccatgatccggcgtccccggtgatcggggtggagttcgtgggcacttcgatctct
tcggggggcgacggtgcggatacggcggccaatacggcgacaatcctggcggagaatccg
catatccgcttccacaacacccagcgcggctatgtccgctgcacgctgacgccggaccgg
ttccaggcggattatctcgtgcttccttatgtgagccggccggatgcgccgatcgagacc
cgcgtttccttcgaggtggaggacggcagaccgggcctgaagaaaatctacgacagcgcg
ctggtggtaacaggctga

DBGET integrated database retrieval system