KEGG   Paenibacillus mucilaginosus 3016: PM3016_835Help
Entry
PM3016_835        CDS       T01757                                 

Definition
protein GtaB
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PM3016_835
   00052 Galactose metabolism
    PM3016_835
   00500 Starch and sucrose metabolism
    PM3016_835
   00520 Amino sugar and nucleotide sugar metabolism
    PM3016_835
Enzymes [BR:pmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PM3016_835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989088..989969
Genome map
AA seq 293 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKGK
RAIEDHFDNYFELEANLQEKGKLDLLAEVRYPTSMADIHYIRQKEPKGLGHAIWCARKFI
GDEPFAVLLGDDIVVSEKPCLQQMIEIFDTYQVSVLGVQNVEPETVSRYGIVDGMQLEDR
VTRVTRLVEKPKREEAPSTQAILGRYILTPRIFDVLENQATGAGGEIQLTDAIAALNRME
AVYAYEFEGTRYDVGEKLGFIQTMLDFSLQRPDLRDDVLAYMQKIVEQAAQLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcaagaaggccatcattcccgcagcaggacttggaacccggttcctgcctgca
accaaagccatgccgaaggaaatgcttccgatcgtggacaagcccacgatccaatacatt
gtagaggaagccgttgcctcgggtattgaggatatcattatcgtaacaggaaaaggcaag
cgggcgatcgaggatcatttcgataactattttgaactcgaagccaatctgcaggagaag
ggcaagctggatctgcttgccgaagtccgttatccgacctccatggcggatatccattat
atccggcagaaggagcccaaaggactgggacatgccatctggtgcgcacggaagtttatc
ggcgacgagccgtttgcggtcctgctgggagatgacattgtcgtctccgagaagccctgc
ctgcagcagatgatcgaaatcttcgatacttaccaggtatccgtactgggtgttcagaat
gtggagcctgagacggtatcccggtatgggatcgtagacggtatgcagcttgaggaccgc
gttacccgtgtaacccggcttgtcgagaagccgaagcgcgaggaggccccgtccactcag
gcgatcctcggacgctatattttaacgccgcggattttcgatgtgctcgagaatcaggct
acgggtgcaggcggagaaattcagctcacggatgcgatcgcagcgctgaaccggatggaa
gccgtctatgcttacgagtttgaaggcacgcggtatgacgtgggcgagaagctgggcttt
atccagacgatgctggatttctccctgcagcggccggatctgcgcgatgatgttctggct
tatatgcagaagatcgtggaacaggccgcccaattgaagtaa

DBGET integrated database retrieval system