KEGG   Proteus mirabilis HI4320: PMI0003Help
Entry
PMI0003           CDS       T00753                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00260  Glycine, serine and threonine metabolism
pmr00750  Vitamin B6 metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01230  Biosynthesis of amino acids
Module
pmr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMI0003 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMI0003 (thrC)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMI0003 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAR40243
UniProt: B4F2U9
Position
3732..5024
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDNQEQVSFAQAVKQGLGKQQGLFFPKDLPSFSQAEIDALLKLDFATRSSRILS
AFIGDEIPADVLAKRVNTAFAFPAPVTQVEEDISCLELFHGPTLAFKDFGGRFMAQMLSE
VAGDQPVTILTATSGDTGAAVAHAFYKLDNVQVVILYPQGKISPLQEKLFCTLGENIHTV
AIQDDFDACQALVKQAFDDEYLKNTMHLNSANSINISRLLAQICYYFEAVAQIPAEKRQQ
LVISVPSGNFGDLTAGLLAKSMGLPVKRFIAATNVNDTVPRYLDSGKWEPHRTIATLSNA
MDVSQPNNWPRIEELYRRKGWLLSDLSHGAVSDETTEKTVRELAQKGYISEPHAAVAYRL
LRDELQEGEYGVFLGTAHPAKFKENVERILGDTLPLPKELAERADKKLLSHLLPADFSQL
RAFLLERAPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatataatttaaaagataaccaagaacaagtcagctttgctcaagctgttaaa
caaggtttaggaaaacagcaaggactcttttttcccaaagacttgccttcattttctcaa
gcagaaattgatgcgctattaaaattagactttgcaacacgcagtagccgtattttaagt
gcttttatcggtgatgaaattcctgctgatgtgttagcaaaacgtgtaaatacggcattt
gcttttcctgcgccagtgacacaagtagaagaggatattagttgccttgaactcttccac
ggaccgacgctggcttttaaagactttggtggccgttttatggctcaaatgttatcagaa
gtcgcgggtgaccagcctgttacaattttaacggcgacatccggtgatacaggagcagcg
gtcgctcatgctttctataagctagataatgtccaggtcgtgatcctctatccacaagga
aaaatcagcccattacaagaaaagctattttgcacattaggggagaatattcatactgtt
gctattcaagatgactttgatgcttgccaagcattagtcaaacaggcatttgatgatgaa
tatttaaagaacaccatgcatttaaactcggctaactcgattaatattagccgcctactg
gcacaaatctgctattactttgaagcggttgcacaaattccagctgaaaaacgtcaacaa
ttagtcatttctgtaccaagtggtaattttggtgatctcactgcaggattactggctaaa
tctatgggattacctgttaaacgctttattgcagcgaccaatgtgaatgataccgttcct
cgctatttagatagtggtaaatgggaaccacatcggacaatagcaacactttcaaatgcg
atggatgttagccagcctaataattggcctcgtattgaagagttatatcgtcgcaaaggt
tggctgttatcggatctttcgcatggggctgtgagcgatgaaacgacggaaaaaactgta
cgtgaactggcacaaaaaggctatatttcagagcctcatgcggcggttgcttatcgtcta
ttacgtgatgagctacaagaaggagaatatggggtatttttaggtacagctcatccggcg
aaatttaaagaaaatgtcgagcgtattttaggtgatacattacctttaccaaaagaatta
gctgagcgtgctgataaaaaattactatcgcatcttttaccggcagatttttctcaatta
agagcatttttgttagaacgagcacctaaataa

DBGET integrated database retrieval system