KEGG   Proteus mirabilis HI4320: PMI0141Help
Entry
PMI0141           CDS       T00753                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmr  Proteus mirabilis HI4320
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMI0141 (recR)
DNA repair and recombination proteins [BR:pmr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PMI0141 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174944..175549
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCCDC
RTFTEEERCTICANARRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
MDIGLDRLEERLSQEPISEVILATNPTVEGEATANYIAEICAQYDIAASRIAHGVPVGGE
LEMVDGTTLSHSIAGRQKIHY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactagccctcttcttgaatcattaatggaagcgttgcgttgtttacccggcgtc
gggccaaaatcagcgcaacgaatggcttttcatctgcttcaacgtgatagaagcggagga
atgcgacttgcacaagcattaacgcgtgcaatgtctgaaattggtcactgttgtgattgt
cgaacatttactgaagaagagcgttgtacgatctgtgctaatgctcgacgtcagcaaaat
ggtcagatatgcgtagtggaaagcccggcagatattcatgctatcgagcagacagggcag
tttgcaggtcgatactttgtgttaatgggacatctatctccgctagatggcattggtccc
atggatattggcttagatagacttgaagagcgtctaagccaagagcctatatcagaagtg
attttagccaccaatcctacggtggaaggtgaagctacagcaaactatattgctgagata
tgcgctcaatatgatattgctgctagcagaatagcacatggcgtgcctgttggtggtgaa
ttagaaatggtggatggtaccacgttgtcacactctatcgcgggacgccagaagatccac
tattaa

DBGET integrated database retrieval system