KEGG   Proteus mirabilis HI4320: PMI0369Help
Entry
PMI0369           CDS       T00753                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418462..419565
Genome map
AA seq 367 aa AA seqDB search
MSSSQTLVVKLGTSVLTGGSRRLDQSHIVELVRQCAKQHEKGHRIIIVTSGAIAAGREYL
NYPDLPATIASKQLLAAVGQSALIQVWKQLFAIYGIHIGQMLLTRADIEDRERFLNARDT
LHALLDNKIIPVINENDAVATAEIKVGDNDNLSALAAILGGADKLLLLTDIEGLYTADPR
SNPDAKLIPEVFDINDELRQMAGDSVSGLGTGGMATKLQAATVAGRAGIDVVIAAGVKPD
VISKVIDNEPVGTLFHGLKSPLETRKRWIFGAPVAGVIIVDNGAEKAIKEQGSSLLPKGI
KEIKGDFSRGCVIRIQSLQGKDLAHGVAHYNSDALRLIAGHHSQEISQILGYEYGSVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcagccaaacgctggttgttaaattagggacaagtgtactgactggtggttca
cgacgtctggatcagtctcatattgtagagctggttcgccaatgtgcaaaacaacacgaa
aaagggcaccggataattattgtcacgtcgggagcaatagcggcagggcgtgaatattta
aactaccccgatttgcccgcaacaatagcatctaaacaactgttagccgctgtggggcaa
agtgctttaattcaggtatggaagcagctatttgctatttatggtattcatattgggcaa
atgttattaactcgcgcggatatagaagatagagaacgttttttgaatgcgcgtgataca
ctgcatgcattattagataacaagattattcctgttatcaatgaaaacgatgccgttgct
actgcagaaataaaagtaggggataacgacaatctttcggcattagctgccattttaggt
ggcgctgataaactcctgttacttactgatatcgaaggtctatatacggccgatcctcgt
agcaatccggatgcgaagcttattcctgaagtttttgatatcaacgatgaattacgtcaa
atggccggtgatagtgtctctggtttaggtactggaggtatggcaactaagttacaagcg
gccactgttgcagggcgtgctggtattgacgttgttattgccgccggtgttaagcctgat
gttatcagtaaagttattgataatgaacctgtcggaacactctttcatggtttaaaaagc
ccccttgaaacgcgtaaacgatggatttttggtgctccagtcgcaggggttatcattgtt
gataatggggctgaaaaggcgattaaagagcaggggagttctcttttacctaaaggtatt
aaagaaattaaaggtgacttttctcgagggtgtgttatccgcattcaaagtttgcaagga
aaagatcttgctcatggtgtcgcgcattataatagtgatgcgctacgcttaattgcgggg
caccattcgcaagagattagtcaaattttaggttatgagtatggcagtgttgcggttcac
cgtgatgatatgattgtgagctag

DBGET integrated database retrieval system