KEGG   Proteus mirabilis HI4320: PMI0491Help
Entry
PMI0491           CDS       T00753                                 

Definition
phage lysozome
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pmr  Proteus mirabilis HI4320
Brite
Enzymes [BR:pmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PMI0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544072..544542
Genome map
AA seq 156 aa AA seqDB search
MSLKQKIAALTTAGATAIALVVIAHFEGVRYEPYRDVAGVLTVCYGHTGKDIIQGKRYTQ
QECDALLQIDFIKTQQQVDALIKVSLDDYTKAALYSFAFNVGTTAFARSTLLKKLNAGDR
AGACEEMKRWIYAGGKVWRGLVSRREAESALCHGKL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaaacagaaaatagcggcgctaacaacagcaggagcaacagccatcgcgtta
gtagtaatagcccattttgaaggtgtacgttatgaaccttatcgtgatgtggcaggtgtt
ctaactgtttgttatggacatacaggcaaagacattattcaaggcaagagatacacacaa
caagaatgtgatgcgttattacaaatcgattttattaagacacaacagcaagtcgatgca
ttaatcaaagtatcactcgatgactacaccaaagctgctttatattcctttgcttttaat
gtgggtacaaccgcatttgctcgctcaacattactcaagaagctaaacgctggtgataga
gcgggtgcctgtgaagaaatgaaacgttggatatatgcaggcggaaaggtctggcgaggg
cttgtcagtcgtcgagaggcggagtcagcactatgtcatggaaaactttaa

DBGET integrated database retrieval system